Protein detail
DPA1
HLA class II histocompatibility antigen, DP alpha 1 chain (DP(W3)) (DP(W4)) (HLA-SB alpha chain) (MHC class II DP3-alpha) (MHC class II DPA1)
Entry name DPA1 | UniProt ID | EVMP confidence score 0.25 |
Supporting publications (n) 1 | Transmembrane count 1 | Protein classification Human disease related genesPredicted intracellular proteinsPredicted membrane proteins |
EVMP confidence score
Annotation confidence score; open for threshold definitions.
Extremely high >= 0.85High >= 0.70Medium >= 0.55Low >= 0.40Basic Information13
Protein Names
HLA class II histocompatibility antigen, DP alpha 1 chain (DP(W3)) (DP(W4)) (HLA-SB alpha chain) (MHC class II DP3-alpha) (MHC class II DPA1)
Protein Class (3)
Human disease related genesPredicted intracellular proteinsPredicted membrane proteins
Protein Function (4)
- Human disease related genes:Immune system diseases:Allergies and autoimmune diseases
- Human disease related genes:Cardiovascular diseases:Cardiac diseases
- Human disease related genes:Skin diseases:Skin and soft tissue diseases
- Predicted intracellular proteins
Transmembrane
223..245; Helical
Transmembrane Count
1
Ensembl
Entrez Gene Symbol
Gene Synonym
HLA-DP1A
Gene Description
Major histocompatibility complex, class II, DP alpha 1
Chromosome
6
Position
33064569-33080775
Supporting publications (n)
1
EVMP confidence score
0.25
Function & Pathway7
Protein Function (4)
- Human disease related genes:Immune system diseases:Allergies and autoimmune diseases
- Human disease related genes:Cardiovascular diseases:Cardiac diseases
- Human disease related genes:Skin diseases:Skin and soft tissue diseases
- Predicted intracellular proteins
Cellular Component (13)
- GO:0000139 Golgi membrane
- GO:0005765 lysosomal membrane
- GO:0005886 plasma membrane
- GO:0009986 cell surface
- GO:0012507 ER to Golgi transport vesicle membrane
- GO:0030658 transport vesicle membrane
- GO:0030666 endocytic vesicle membrane
- GO:0030669 clathrin-coated endocytic vesicle membrane
- GO:0031902 late endosome membrane
- GO:0032588 trans-Golgi network membrane
Page 1 of 2
Molecular Function (3)
Biological Process (3)
- GO:1904282 regulation of antigen processing and presentation of endogenous peptide antigen via MHC class I
- GO:1904283 negative regulation of antigen processing and presentation of endogenous peptide antigen via MHC class I
- GO:0002589 regulation of antigen processing and presentation of peptide antigen via MHC class I
KEGG (24)
- hsa04145 Phagosome
- KEGG:hsa04514 Cell adhesion molecule (CAM) interaction
- KEGG:hsa04612 Antigen processing and presentation
- KEGG:hsa04640 Hematopoietic cell lineage
- KEGG:hsa04658 Th1 and Th2 cell differentiation
- KEGG:hsa04659 Th17 cell differentiation
- KEGG:hsa04672 Intestinal immune network for IgA production
- KEGG:hsa04940 Type I diabetes mellitus
- KEGG:hsa05140 Leishmaniasis
- KEGG:hsa05145 Toxoplasmosis
Page 1 of 3
Reactome (11)
- R-hsa-1280218 adaptive immune system
- R-hsa-389948 co inhibition by pd 1
- R-hsa-1280215 cytokine signaling in immune system
- R-hsa-202424 downstream tcr signaling
- R-hsa-202433 generation of second messenger molecules
- R-hsa-877300 interferon gamma signaling
- R-hsa-913531 interferon signaling
- R-hsa-2132295 mhc class ii antigen presentation
- R-hsa-202427 phosphorylation of cd3 and tcr zeta chains
- R-hsa-388841 regulation of t cell activation by cd28 family
Page 1 of 2
Mediation Categories (3)
Adhesion and uptake mediationFusion and delivery mediationImmune mediation
Relations & Evidence47
Ligand-Receptor Signaling (35)
35 records.
| Category | Parent | Database | Transmitter | Receiver | Secreted | Plasma Membrane (Transmembrane) | Plasma Membrane (Peripheral) |
|---|---|---|---|---|---|---|---|
| receptor | receptor | CellCellInteractions | No | Yes | No | Yes | No |
| transmembrane | transmembrane_predicted | Phobius | No | No | No | Yes | No |
| transmembrane_phobius | transmembrane_predicted | Almen2009 | No | No | No | Yes | No |
| transmembrane_sosui | transmembrane_predicted | Almen2009 | No | No | No | Yes | No |
| transmembrane_tmhmm | transmembrane_predicted | Almen2009 | No | No | No | Yes | No |
Page 4 of 4Previous
Protein Complex Composition (11)
Isolation & Detection Technology (1)
1 record.
| EV Isolation Method | Detection Method | Number of References | References |
|---|---|---|---|
| Differential Ultracentrifugation | Mass spectrometry | 1 | 38795909 |
Sequence, Structure & Domains11
Sequences
Length
260
Mass
29,381
Sequence
MRPEDRMFHIRAVILRALSLAFLLSLRGAGAIKADHVSTYAAFVQTHRPTGEFMFEFDEDEMFYVDLDKKETVWHLEEFGQAFSFEAQGGLANIAILNNNLNTLIQRSNHTQATNDPPEVTVFPKEPVELGQPNTLICHIDKFFPPVLNVTWLCNGELVTEGVAESLFLPRTDYSFHKFHYLTFVPSAEDFYDCRVEHWGLDQPLLKHWEAQEPIQMPETTETVLCALGLVLGLVGIIVGTVLIIKSLRSGHDPRAQGTL
3D Structural Models
Turn
67..70
Helix
77..82; 87..107
Beta Strand
35..49; 51..57; 60..66; 71..76; 119..126; 134..146; 149..154; 157..159; 161..165; 176..184; 191..197; 201..203; 205..210
3D Structure
X-ray crystallography (10)
Domain & Motif Annotations
Domain (FT)
118..210; Ig-like C1-type
Region
29..115; Alpha-1; 116..209; Alpha-2; 210..222; Connecting peptide
Protein Families
MHC class II family
Sequence Similarities
Belongs to the MHC class II family.
Clinical Relevance5
Antibody
Interaction Protein
ENSG00000157637
Interaction Count
1
Interaction Dataset
biogrid_bioplex
Supporting Publications1
| PMID | Title | Abstract |
|---|---|---|
| 31805958 | Proteomic analysis of cerebrospinal fluid extracellular vesicles reveals synaptic injury, inflammation, and stress response markers in HIV patients with cognitive impairment. | No abstract available |