Protein detail
CD33
Myeloid cell surface antigen CD33 (Sialic acid-binding Ig-like lectin 3) (Siglec-3) (gp67) (CD antigen CD33)
Entry name CD33 | UniProt ID | EVMP score 0.38 |
Frequency 5 | Transmembrane count 1 | Protein classification CD markersFDA approved drug targetsPlasma proteinsPredicted membrane proteins |
EVMP score: annotation confidence score.
Extremely high >= 0.85High >= 0.70Medium >= 0.55Low >= 0.40
Basic Information
Protein Names
Myeloid cell surface antigen CD33 (Sialic acid-binding Ig-like lectin 3) (Siglec-3) (gp67) (CD antigen CD33)
Protein Class
CD markersFDA approved drug targetsPlasma proteinsPredicted membrane proteins
Protein Function
- CD markers
- FDA approved drug targets:Biotech drugs
Transmembrane
260..282; Helical
Transmembrane Count
1
Ensembl
Entrez Gene Symbol
Gene Synonym
FLJ00391p67SIGLEC-3SIGLEC3
Gene Description
CD33 molecule
Chromosome
19
Position
51225064-51243860
Frequency
5
EVMP Score
0.38
Fluorescence & Localization
Cell SpecificNeutrophilsSingle-Nuclei Brain Specificmedium spiny neuronBlood Cell SpecificbasophilBlood Lineage Specificgranulocytes
Function & Pathway
Protein Function
- CD markers
- FDA approved drug targets:Biotech drugs
Cellular Component
Molecular Function
Biological Process
Reactome
- R-hsa-1280218 adaptive immune system
- R-hsa-9918485 dengue virus attachment and entry
- R-hsa-9839923 dengue virus infection
- R-hsa-198933 immunoregulatory interactions between a lymphoid and a non lymphoid cell
- R-hsa-5663205 infectious disease
- R-hsa-168249 innate immune system
- R-hsa-6798695 neutrophil degranulation
- R-hsa-9824446 viral infection pathways
Mediation Categories
Clinical-translation mediationFusion and delivery mediationImmune mediation
Relations & Evidence
Enzyme-Mediated Modification
5 records.
| Substrate Gene Symbol | Enzyme Gene Symbol | Enzyme UniProt ID | Residue Type | Residue Offset | Modification | Database | References |
|---|---|---|---|---|---|---|---|
| CD33 | LCK | P06239 | Y | 340 | phosphorylation | phosphoELM_MIMPPhosphoSite_MIMPMIMPHPRD_MIMPSIGNORProtMapperKEAphosphoELMSIGNOR_ProtMapperPhosphoSitePhosphoSite_ProtMapper | SIGNOR:10887109ProtMapper:10887109KEA:10887109KEA:10206955phosphoELM:10887109 |
| CD33 | SRC | P12931 | Y | 340 | phosphorylation | phosphoELM_MIMPPhosphoSite_MIMPMIMPHPRD_MIMPKEAphosphoELMLi2012 | phosphoELM:10887109KEA:10887109KEA:10206955 |
| CD33 | PTPN6 | P29350 | Y | 340 | dephosphorylation | HPRD | HPRD:10206955 |
| CD33 | EGFR | P00533 | Y | 340 | phosphorylation | KEA | KEA:17570479 |
| CD33 | LYN | P07948 | Y | 340 | phosphorylation | KEA | KEA:17570479 |
Ligand-Receptor Signaling
40 records.
| Category | Parent | Database | Transmitter | Receiver | Secreted | Plasma Membrane (Transmembrane) | Plasma Membrane (Peripheral) |
|---|---|---|---|---|---|---|---|
| transmembrane | transmembrane | TopDB | No | No | No | Yes | No |
| transmembrane | transmembrane | Ramilowski_location | No | No | No | Yes | No |
| transmembrane | transmembrane | OmniPath | No | No | No | Yes | No |
| plasma_membrane | plasma_membrane | UniProt_location | No | No | No | Yes | No |
| plasma_membrane | plasma_membrane | Cellinker | No | No | No | Yes | No |
| plasma_membrane | plasma_membrane | OmniPath | No | No | No | Yes | No |
| plasma_membrane_transmembrane | plasma_membrane_transmembrane | Membranome | No | No | No | Yes | No |
| plasma_membrane_transmembrane | plasma_membrane_transmembrane | CSPA | No | No | No | Yes | No |
| plasma_membrane_transmembrane | plasma_membrane_transmembrane | OmniPath | No | No | No | Yes | No |
| cell_surface | cell_surface | Surfaceome | No | No | No | Yes | No |
Regulatory Interaction Network
1 record.
| Source Protein Symbol | Source UniProt ID | Target Protein Symbol | Target UniProt ID | Is Directed | Is Stimulation | Is Inhibition | Database | References |
|---|---|---|---|---|---|---|---|---|
| LCK | P06239 | CD33 | P20138 | Yes | Yes | No | WangphosphoELM_MIMPPhosphoSite_MIMPMIMPHPRD_MIMPiPTMnetSIGNORProtMapperPhosphoSite_KEAKEAphosphoELM_KEAphosphoELMSIGNOR_ProtMapperPhosphoSitePhosphoSite_ProtMapper | SIGNOR:10887109ProtMapper:10887109PhosphoSite:10206955KEA:10887109KEA:10206955phosphoELM:10887109PhosphoSite:10887109 |
Protein Complex Composition
Isolation & Detection Technology
1 record.
| EV Isolation Method | Detection Method | Number of References | References |
|---|---|---|---|
| Protein Organic Solvent Precipitation | Mass spectrometry | 1 | 32384937 |
Sequence, Structure & Domains
Sequences
Length
364
Mass
39,825
Sequence
MPLLLLLPLLWAGALAMDPNFWLQVQESVTVQEGLCVLVPCTFFHPIPYYDKNSPVHGYWFREGAIISRDSPVATNKLDQEVQEETQGRFRLLGDPSRNNCSLSIVDARRRDNGSYFFRMERGSTKYSYKSPQLSVHVTDLTHRPKILIPGTLEPGHSKNLTCSVSWACEQGTPPIFSWLSAAPTSLGPRTTHSSVLIITPRPQDHGTNLTCQVKFAGAGVTTERTIQLNVTYVPQNPTTGIFPGDGSGKQETRAGVVHGAIGGAGVTALLALCLCLIFFIVKTHRRKAARTAVGRNDTHPTTGSASPKHQKKSKLHGPTETSSCSGAAPTVEMDEELHYASLNFHGMNPSKDTSTEYSEVRTQ
Alternative Products
Event=Alternative splicing; Named isoforms=3; Name=CD33M; IsoId=P20138-1; Sequence=Displayed; Name=3; IsoId=P20138-2; Sequence=VSP_045364; Name=CD33m; IsoId=P20138-3; Sequence=VSP_046172
Alternative Sequence
13..139; Missing (in isoform CD33m); 309..364; KHQKKSKLHGPTETSSCSGAAPTVEMDEELHYASLNFHGMNPSKDTSTEYSEVRTQ -> VR (in isoform 3)
3D Structural Models
Turn
67..69; 84..89
Helix
49..51; 96..98; 110..112; 203..205
Beta Strand
22..25; 27..32; 37..39; 41..44; 56..62; 73..76; 90..92; 103..105; 114..122; 125..128; 134..139; 146..148; 159..164; 176..191; 194..199; 209..215; 217..220; 222..228
3D Structure
NMR spectroscopy (1); X-ray crystallography (8)
Domain & Motif Annotations
Motif
338..343; ITIM motif 1; 356..361; ITIM motif 2
Domain (CC)
Contains 2 copies of a cytoplasmic motif that is referred to as the immunoreceptor tyrosine-based inhibitor motif (ITIM). This motif is involved in modulation of cellular responses. The phosphorylated ITIM motif can bind the SH2 domain of several SH2-containing phosphatases.
Domain (FT)
19..135; Ig-like V-type; 145..228; Ig-like C2-type
Region
290..364; Disordered
Protein Families
- Immunoglobulin superfamily
- SIGLEC (sialic acid binding Ig-like lectin) family
Sequence Similarities
Belongs to the immunoglobulin superfamily. SIGLEC (sialic acid binding Ig-like lectin) family.
Clinical Relevance
Disease Involvement
FDA approved drug targets
Related Diseases
Biomarker
Approved; Phase 1; Phase 1/2; Phase 2
Drug Targets
FDA approved drug targets
Drugs
Interaction Protein
ENSG00000111679ENSG00000179295
Interaction Count
2
Interaction Dataset
intact_biogrid