Protein detail
CD33
Myeloid cell surface antigen CD33 (Sialic acid-binding Ig-like lectin 3) (Siglec-3) (gp67) (CD antigen CD33)
Entry name CD33 | UniProt ID | EVMP confidence score 0.53 |
Supporting publications (n) 5 | Transmembrane count 1 | Protein classification CD markersFDA approved drug targetsPlasma proteinsPredicted membrane proteins |
Annotation confidence score; open for threshold definitions.
Extremely high >= 0.70High >= 0.60Medium >= 0.40Low >= 0.30Basic Information
Protein Names
Myeloid cell surface antigen CD33 (Sialic acid-binding Ig-like lectin 3) (Siglec-3) (gp67) (CD antigen CD33)
Protein Class (4)
CD markersFDA approved drug targetsPlasma proteinsPredicted membrane proteins
Protein Function (2)
- CD markers
- FDA approved drug targets:Biotech drugs
Transmembrane
260..282; Helical
Transmembrane Count
1
Ensembl
Entrez Gene Symbol
Gene Synonym (4)
FLJ00391p67SIGLEC-3SIGLEC3
Gene Description
CD33 molecule
Chromosome
19
Position
51225064-51243860
Supporting publications (n)
5
EVMP confidence score
0.53
Fluorescence & Localization
Cell SpecificNeutrophilsSingle-Nuclei Brain Specificmedium spiny neuronBlood Cell SpecificbasophilBlood Lineage Specificgranulocytes
Function & Pathway
Protein Function (2)
- CD markers
- FDA approved drug targets:Biotech drugs
Cellular Component (8)
Molecular Function (6)
Biological Process (3)
Reactome (8)
- R-hsa-1280218 adaptive immune system
- R-hsa-9918485 dengue virus attachment and entry
- R-hsa-9839923 dengue virus infection
- R-hsa-198933 immunoregulatory interactions between a lymphoid and a non lymphoid cell
- R-hsa-5663205 infectious disease
- R-hsa-168249 innate immune system
- R-hsa-6798695 neutrophil degranulation
- R-hsa-9824446 viral infection pathways
Mediation Categories (3)
Clinical-translation mediationFusion and delivery mediationImmune mediation
Relations & Evidence48
Enzyme-Mediated Modification (5)
5 records.
| Substrate Gene Symbol | Enzyme Gene Symbol | Enzyme UniProt ID | Residue Type | Residue Offset | Modification | Database | References |
|---|---|---|---|---|---|---|---|
| CD33 | LCK | P06239 | Y | 340 | phosphorylation | phosphoELM_MIMPPhosphoSite_MIMPMIMPHPRD_MIMPSIGNORProtMapperKEAphosphoELMSIGNOR_ProtMapperPhosphoSitePhosphoSite_ProtMapper | SIGNOR:10887109ProtMapper:10887109KEA:10887109KEA:10206955phosphoELM:10887109 |
| CD33 | SRC | P12931 | Y | 340 | phosphorylation | phosphoELM_MIMPPhosphoSite_MIMPMIMPHPRD_MIMPKEAphosphoELMLi2012 | phosphoELM:10887109KEA:10887109KEA:10206955 |
| CD33 | PTPN6 | P29350 | Y | 340 | dephosphorylation | HPRD | HPRD:10206955 |
| CD33 | EGFR | P00533 | Y | 340 | phosphorylation | KEA | KEA:17570479 |
| CD33 | LYN | P07948 | Y | 340 | phosphorylation | KEA | KEA:17570479 |
Ligand-Receptor Signaling (40)
40 records.
| Category | Parent | Database | Transmitter | Receiver | Secreted | Plasma Membrane (Transmembrane) | Plasma Membrane (Peripheral) |
|---|---|---|---|---|---|---|---|
| intracellular | intracellular | OmniPath | Yes | ||||
| ig_like | adhesion | Almen2009 | Yes | Yes | Yes | ||
| cell_adhesion | cell_adhesion | Cellinker | Yes | Yes | Yes | ||
| cell_adhesion | cell_adhesion | Zhong2015 | Yes | Yes | Yes | ||
| adhesion | adhesion | OmniPath | Yes | Yes | Yes | ||
| cell_adhesion | cell_adhesion | OmniPath | Yes | Yes | Yes | ||
| transmembrane | transmembrane | UniProt_location | Yes | ||||
| transmembrane | transmembrane | UniProt_topology | Yes | ||||
| transmembrane | transmembrane | UniProt_keyword | Yes | ||||
| transmembrane_predicted | transmembrane | OmniPath | Yes |
Regulatory Interaction Network (1)
1 record.
| Source Protein Symbol | Source UniProt ID | Target Protein Symbol | Target UniProt ID | Is Directed | Is Stimulation | Is Inhibition | Database | References |
|---|---|---|---|---|---|---|---|---|
| LCK | P06239 | CD33 | P20138 | Yes | Yes | WangphosphoELM_MIMPPhosphoSite_MIMPMIMPHPRD_MIMPiPTMnetSIGNORProtMapperPhosphoSite_KEAKEAphosphoELM_KEAphosphoELMSIGNOR_ProtMapperPhosphoSitePhosphoSite_ProtMapper | SIGNOR:10887109ProtMapper:10887109PhosphoSite:10206955KEA:10887109KEA:10206955phosphoELM:10887109PhosphoSite:10887109 |
Protein Complex Composition (1)
Isolation & Detection Technology (1)
1 record.
| EV Isolation Method | Detection Method | Number of References | References |
|---|---|---|---|
| Protein Organic Solvent Precipitation | Mass spectrometry | 1 | 32384937 |
Sequence, Structure & Domains
Sequences
Length
364
Mass
39,825
Sequence
MPLLLLLPLLWAGALAMDPNFWLQVQESVTVQEGLCVLVPCTFFHPIPYYDKNSPVHGYWFREGAIISRDSPVATNKLDQEVQEETQGRFRLLGDPSRNNCSLSIVDARRRDNGSYFFRMERGSTKYSYKSPQLSVHVTDLTHRPKILIPGTLEPGHSKNLTCSVSWACEQGTPPIFSWLSAAPTSLGPRTTHSSVLIITPRPQDHGTNLTCQVKFAGAGVTTERTIQLNVTYVPQNPTTGIFPGDGSGKQETRAGVVHGAIGGAGVTALLALCLCLIFFIVKTHRRKAARTAVGRNDTHPTTGSASPKHQKKSKLHGPTETSSCSGAAPTVEMDEELHYASLNFHGMNPSKDTSTEYSEVRTQ
Alternative Products
Event=Alternative splicing; Named isoforms=3; Name=CD33M; IsoId=P20138-1; Sequence=Displayed; Name=3; IsoId=P20138-2; Sequence=VSP_045364; Name=CD33m; IsoId=P20138-3; Sequence=VSP_046172
Alternative Sequence
13..139; Missing (in isoform CD33m); 309..364; KHQKKSKLHGPTETSSCSGAAPTVEMDEELHYASLNFHGMNPSKDTSTEYSEVRTQ -> VR (in isoform 3)
3D Structural Models
Turn
67..69; 84..89
Helix
49..51; 96..98; 110..112; 203..205
Beta Strand
22..25; 27..32; 37..39; 41..44; 56..62; 73..76; 90..92; 103..105; 114..122; 125..128; 134..139; 146..148; 159..164; 176..191; 194..199; 209..215; 217..220; 222..228
3D Structure
NMR spectroscopy (1); X-ray crystallography (8)
Domain & Motif Annotations
Motif
338..343; ITIM motif 1; 356..361; ITIM motif 2
Domain (CC)
Contains 2 copies of a cytoplasmic motif that is referred to as the immunoreceptor tyrosine-based inhibitor motif (ITIM). This motif is involved in modulation of cellular responses. The phosphorylated ITIM motif can bind the SH2 domain of several SH2-containing phosphatases.
Domain (FT)
19..135; Ig-like V-type; 145..228; Ig-like C2-type
Region
290..364; Disordered
Protein Families (2)
- Immunoglobulin superfamily
- SIGLEC (sialic acid binding Ig-like lectin) family
Sequence Similarities
Belongs to the immunoglobulin superfamily. SIGLEC (sialic acid binding Ig-like lectin) family.
Clinical Relevance
Disease Involvement
FDA approved drug targets
Related Diseases (8)
Biomarker
Approved; Phase 1; Phase 1/2; Phase 2
Drug Targets
FDA approved drug targets
Drugs (14)
Interaction Protein (2)
ENSG00000111679ENSG00000179295
Interaction Count
2
Interaction Dataset
intact_biogrid
Supporting Publications5
| PMID | Title | Related sentences |
|---|---|---|
| 33592500 | A Proteomic Approach to Understand the Clinical Significance of Acute Myeloid Leukemia-Derived Extracellular Vesicles Reflecting Essential Characteristics of Leukemia. | No related sentences available |
| 38014595 | Proteome and immune responses of extracellular vesicles derived from macrophages infected with the periodontal pathogen Tannerella forsythia. | No related sentences available |
| 40730843 | Single urinary extracellular vesicle proteomics identifies complement receptor CD35 as a biomarker for sepsis-associated acute kidney injury. | No related sentences available |
| 41068253 | Identification of plasma extracellular vesicle protein biomarkers in diabetic retinopathy progression. | No related sentences available |
| 41307968 | Extracellular Vesicles Define Discrete Nano-Based Niches Within the Human Haematopoietic System. | No related sentences available |