Protein detail
CD9
CD9 antigen (5H9 antigen) (Cell growth-inhibiting gene 2 protein) (Leukocyte antigen MIC3) (Motility-related protein) (MRP-1) (Tetraspanin-29) (Tspan-29) (p24) (CD antigen CD9)
Entry name CD9 | UniProt ID | EVMP confidence score 0.88 |
Supporting publications (n) 424 | Transmembrane count 4 | Protein classification Cancer-related genesCD markersPlasma proteinsPredicted membrane proteinsTransporters |
EVMP confidence score
Annotation confidence score; open for threshold definitions.
Extremely high >= 0.85High >= 0.70Medium >= 0.55Low >= 0.40Basic Information13
Protein Names
CD9 antigen (5H9 antigen) (Cell growth-inhibiting gene 2 protein) (Leukocyte antigen MIC3) (Motility-related protein) (MRP-1) (Tetraspanin-29) (Tspan-29) (p24) (CD antigen CD9)
Protein Class (5)
Cancer-related genesCD markersPlasma proteinsPredicted membrane proteinsTransporters
Protein Function (3)
- Cancer-related genes:Candidate cancer biomarkers
- CD markers
- Transporters:Accessory Factors Involved in Transport
Transmembrane
13..33; Helical; 56..76; Helical; 88..111; Helical; 196..221; Helical
Transmembrane Count
4
Ensembl
Entrez Gene Symbol
Gene Synonym (5)
BA2MIC3MRP-1P24TSPAN29
Gene Description
CD9 molecule
Chromosome
12
Position
6199715-6238271
Supporting publications (n)
424
EVMP confidence score
0.88
Fluorescence & Localization1
Function & Pathway7
Protein Function (3)
- Cancer-related genes:Candidate cancer biomarkers
- CD markers
- Transporters:Accessory Factors Involved in Transport
Cellular Component (11)
- GO:0005615 extracellular space
- GO:0005886 plasma membrane
- GO:0005925 focal adhesion
- GO:0009897 external side of plasma membrane
- GO:0016020 membrane
- GO:0030666 endocytic vesicle membrane
- GO:0030669 clathrin-coated endocytic vesicle membrane
- GO:0031092 platelet alpha granule membrane
- GO:0032991 protein-containing complex
- GO:0070062 extracellular exosome
Page 1 of 2
Molecular Function (2)
Biological Process (3)
Reactome (10)
- R-hsa-1300645 acrosome reaction and sperm oocyte membrane binding
- R-hsa-9824439 bacterial infection pathways
- R-hsa-1187000 fertilization
- R-hsa-109582 hemostasis
- R-hsa-5663205 infectious disease
- R-hsa-76002 platelet activation signaling and aggregation
- R-hsa-1474165 reproduction
- R-hsa-76005 response to elevated platelet cytosolic ca2
- R-hsa-5339562 uptake and actions of bacterial toxins
- R-hsa-5336415 uptake and function of diphtheria toxin
Mediation Categories (4)
Adhesion and uptake mediationClinical-translation mediationFusion and delivery mediationImmune mediation
Relations & Evidence41
Ligand-Receptor Signaling (32)
32 records.
| Category | Parent | Database | Transmitter | Receiver | Secreted | Plasma Membrane (Transmembrane) | Plasma Membrane (Peripheral) |
|---|---|---|---|---|---|---|---|
| extracellular | extracellular | HPMR | No | No | Yes | No | No |
| extracellular | extracellular | DGIdb | No | No | Yes | No | No |
| extracellular | extracellular | OmniPath | No | No | Yes | No | No |
| intracellular | intracellular | LOCATE | No | No | Yes | No | No |
| intracellular | intracellular | ComPPI | No | No | Yes | No | No |
| intracellular | intracellular | GO_Intercell | No | No | Yes | No | No |
| intracellular | intracellular | OmniPath | No | No | Yes | No | No |
| cell_surface_ligand | cell_surface_ligand | connectomeDB2020 | Yes | No | Yes | No | No |
| cell_surface_ligand | cell_surface_ligand | Baccin2019 | Yes | No | Yes | No | No |
| cell_surface_ligand | cell_surface_ligand | OmniPath | Yes | No | Yes | No | No |
Page 1 of 4Next
Protein Complex Composition (8)
8 records.
| Component Name | Component Gene Symbols | Component UniProt ID | Stoichiometry | Database | Database IDs | References |
|---|---|---|---|---|---|---|
| ASAP3CD96CER1HSPA1BLDB3 | O75112O95813P0DMV9P40200Q8TDY4 | 0:0:0:0:0 | hu.MAP2 | |||
| CD96HSPA1ALDB3 | O75112P0DMV8P40200 | 0:0:0 | hu.MAP | |||
| CD96HSPA1BLDB3 | O75112P0DMV9P40200 | 0:0:0 | hu.MAP | |||
| AFG2BCD96HSPA1BLDB3 | O75112P0DMV9P40200Q9BVQ7 | 0:0:0:0 | hu.MAP2 | |||
| CCNB2CD96CRHBPNAA20POGLUT1SQSTM1TNIP1 | O95067P24387P40200P61599Q13501Q15025Q8NBL1 | 0:0:0:0:0:0:0 | hu.MAP2 | |||
| CD99 | P14209 | 2 | PDB | PDB:7sfx | ||
| CD9 | P21926 | 4 | PDB | PDB:6z20PDB:6rlrPDB:6rlo | ||
| CD93 | Q9NPY3 | 4 | PDB | PDB:8ivd |
Sequence, Structure & Domains8
Sequences
Length
228
Mass
25,416
Sequence
MPVKGGTKCIKYLLFGFNFIFWLAGIAVLAIGLWLRFDSQTKSIFEQETNNNNSSFYTGVYILIGAGALMMLVGFLGCCGAVQESQCMLGLFFGFLLVIFAIEIAAAIWGYSHKDEVIKEVQEFYKDTYNKLKTKDEPQRETLKAIHYALNCCGLAGGVEQFISDICPKKDVLETFTVKSCPDAIKEVFDNKFHIIGAVGIGIAVVMIFGMIFSMILCCAIRRNREMV
3D Structural Models
Turn
154..156; 169..172
Helix
5..37; 41..45; 55..82; 86..111; 114..133; 137..139; 140..150; 161..166; 173..175; 181..190; 193..222
3D Structure
X-ray crystallography (5)
Domain & Motif Annotations
Protein Families
Tetraspanin (TM4SF) family
Sequence Similarities
Belongs to the tetraspanin (TM4SF) family.
Clinical Relevance6
Disease Involvement
Cancer-related genes
Drugs (43)
FLUOXETINE HYDROCHLORIDEDOTHIEPINPROPIONIBACTERIUM ACNESNORZOTEPINECITALOPRAMZIPRASIDONEMILNACIPRANVENLAFAXINEIMIPRAMINE HYDROCHLORIDELUMATEPERONEFLUVOXAMINERECOMBINANT EOTAXINTHERAPEUTIC STEROID HORMONEPAROXETINE HYDROCHLORIDE, HEMIHYDRATESIBUTRAMINETYROSINE KINASE INHIBITORLEVOMILNACIPRANATOMOXETINE HYDROCHLORIDEVORTIOXETINE HYDROBROMIDEZOTEPINEPROTRIPTYLINEDULOXETINE HYDROCHLORIDENORTRIPTYLINE[3H]PAROXETINERECOMBINANT INTERLEUKIN-16LIFTHERAPEUTIC ANDROGENDESIPRAMINEAMOXAPINESERTRALINE HYDROCHLORIDEIL-5DESVENLAFAXINE SUCCINATELOFEPRAMINEDOXEPIN HYDROCHLORIDECLOMIPRAMINETOLUDESVENLAFAXINEHERBIMYCIN ANEFAZODONEPHENELZINEVILAZODONE HYDROCHLORIDEDAPOXETINEAMITRIPTYLINE HYDROCHLORIDETRIMIPRAMINE
Antibody
Interaction Protein (2)
ENSG00000110651ENSG00000134247
Interaction Count
2
Interaction Dataset (2)
biogrid_opencellintact_biogrid_opencell
Supporting Publications409
| PMID | Title | Abstract |
|---|---|---|
| 31044144 | Exosome-enriched fractions from MS B cells induce oligodendrocyte death. | Exosome-enriched (Ex-En) fractions were prepared by solvent precipitation from Sup containing bovine serum and from serum-free Sup by ultracentrifugation (UC) or immunoprecipitation (IP) with antibodies to CD9. |
| 31048929 | Clinical impact of different exosomes' protein expression in pancreatic ductal carcinoma patients treated with standard first line palliative chemotherapy. | Pancreatic cancer patients exosomes express EpCAM, whose levels change during treatment. This represents a useful prognostic factor and also suggests that future treatment modalities who target EpCAM should be tested in pancreatic cancer patients selected by exosome EpCAM expression. We quantified by an ELISA-based technique specific proteins of cancer-derived exosomes (CD44,CD44v6,EpCAM,CD9,CD81,Tspan8,Integrin α6,Integrin β4,CD24,CXCR4). |
| 31078263 | Oral keratinocyte-derived exosomes regulate proliferation of fibroblasts and epithelial cells. | The exosomes were probed for classical EV-markers by western blot (CD9, annexin V and Flotillin-1), FEx were positive for all markers while OKEx were positive only for CD9. |
| 31090350 | [Effects of icariin on autophagy and exosome production of bone microvascular endothelial cells]. | On the basis of hydrocortisone intervention, 5×10 With the increase of hydrocortisone concentration, the protein expression of LC3B-Ⅱ increased gradually, and the protein expression of p62 decreased gradually ( Icariin and BMECs-derived exosomes can improve the autophagy of BMECs induced by low concentration of glucocorticoid. |
| 31100946 | Extra Purified Exosomes from Human Placenta Contain An Unpredictable Small Number of Different Major Proteins. | Good, purified exosomes contained only 11-13 different proteins: CD9, CD81, CD-63, hemoglobin subunits, interleukin-1 receptor, annexin A1, annexin A2, annexin A5, cytoplasmic actin, alkaline phosphatase, serotransferin, and probably human serum albumin and immunoglobulins. |
| 31136209 | Ultrastructural identification of CD9 positive extracellular vesicles released from human embryos and transported through the zona pellucida. | No abstract available |
| 31196738 | Exosome-derived uterine microRNAs isolated from cows with endometritis impede blastocyst development. | Identified with Western blotting, positive CD63 and CD9 expressions showed that the isolated exosomes could be used for the subsequent tests. |
| 31220525 | Exosomal Notch3 from high glucose-stimulated endothelial cells regulates vascular smooth muscle cells calcification/aging. | The presence of exosome markers including CD9, CD63 and TSG101 were also detected in HG-HUVEC-Exo. |
| 31399634 | Extracellular vesicles isolated from porcine seminal plasma exhibit different tetraspanin expression profiles. | (2) Tetraspanins CD9, CD63 and CD81 are present in both seminal EVs, albeit with exosomes and MVs differing in expression profiles, suggesting dissimilar cargo and binding affinity. Flow cytometric analysis demonstrated that the proportion of EVs expressing CD63 and CD9 was higher in MVs (P < 0.001 and P < 0.05, respectively) than in exosomes, while the opposite was true for CD81; higher (P < 0.001) in exosomes than in MVs. |
| 31399645 | Glioma-associated human endothelial cell-derived extracellular vesicles specifically promote the tumourigenicity of glioma stem cells via CD9. | No abstract available |