Protein detail
EDNRB
Endothelin receptor type B (ET-B) (ET-BR) (Endothelin receptor non-selective type)
Entry name EDNRB | UniProt ID | EVMP confidence score 0.50 |
Supporting publications (n) 2 | Transmembrane count 7 | Protein classification Disease related genesFDA approved drug targetsG-protein coupled receptorsHuman disease related genesPredicted membrane proteins |
EVMP confidence score
Annotation confidence score; open for threshold definitions.
Extremely high >= 0.85High >= 0.70Medium >= 0.55Low >= 0.40Basic Information13
Protein Names
Endothelin receptor type B (ET-B) (ET-BR) (Endothelin receptor non-selective type)
Protein Class (5)
Disease related genesFDA approved drug targetsG-protein coupled receptorsHuman disease related genesPredicted membrane proteins
Protein Function (7)
- Human disease related genes:Cancers:Head and neck cancers
- Human disease related genes:Other diseases:Others
- Human disease related genes:Congenital disorders of metabolism:Other congenital disorders of metabolism
- Human disease related genes:Congenital malformations:Congenital malformations of the digestive system
- G-protein coupled receptors:GPCRs excl olfactory receptors
- Disease related genes
- FDA approved drug targets:Small molecule drugs
Transmembrane
102..126; Helical; Name=1; 138..163; Helical; Name=2; 176..197; Helical; Name=3; 219..243; Helical; Name=4; 272..296; Helical; Name=5; 325..350; Helical; Name=6; 363..389; Helical; Name=7
Transmembrane Count
7
Ensembl
Entrez Gene Symbol
Gene Synonym (3)
ETBHSCRHSCR2
Gene Description
Endothelin receptor type B
Chromosome
13
Position
77895481-77975529
Supporting publications (n)
2
EVMP confidence score
0.50
Fluorescence & Localization3
Secretome LocationIntracellular and membraneSecretome FunctionTransport
Function & Pathway8
Protein Function (7)
- Human disease related genes:Cancers:Head and neck cancers
- Human disease related genes:Other diseases:Others
- Human disease related genes:Congenital disorders of metabolism:Other congenital disorders of metabolism
- Human disease related genes:Congenital malformations:Congenital malformations of the digestive system
- G-protein coupled receptors:GPCRs excl olfactory receptors
- Disease related genes
- FDA approved drug targets:Small molecule drugs
Cellular Component (2)
Molecular Function (4)
Biological Process (3)
KEGG (6)
Reactome (7)
- R-hsa-373076 class a 1 rhodopsin like receptors
- R-hsa-500792 gpcr ligand binding
- R-hsa-416476 g alpha q signalling events
- R-hsa-9730414 mitf m regulated melanocyte development
- R-hsa-375276 peptide ligand binding receptors
- R-hsa-372790 signaling by gpcr
- R-hsa-9856649 transcriptional and post translational regulation of mitf m expression and activity
Canonical Pathways (3)
- M3468 Naba ecm regulators
- M5885 Naba matrisome associated
- M5889 Naba matrisome
Mediation Categories (5)
Clinical-translation mediationFusion and delivery mediationImmune mediationMetabolism mediationReceptor-signaling mediation
Relations & Evidence80
Ligand-Receptor Signaling (64)
64 records.
| Category | Parent | Database | Transmitter | Receiver | Secreted | Plasma Membrane (Transmembrane) | Plasma Membrane (Peripheral) |
|---|---|---|---|---|---|---|---|
| receptor | receptor | CellPhoneDB | No | Yes | No | Yes | No |
| receptor | receptor | HPMR | No | Yes | No | Yes | No |
| receptor | receptor | ICELLNET | No | Yes | No | Yes | No |
| receptor | receptor | CellChatDB | No | Yes | No | Yes | No |
| receptor | receptor | CellTalkDB | No | Yes | No | Yes | No |
| receptor | receptor | Surfaceome | No | Yes | No | Yes | No |
| receptor | receptor | Ramilowski2015 | No | Yes | No | Yes | No |
| receptor | receptor | Kirouac2010 | No | Yes | No | Yes | No |
| receptor | receptor | Guide2Pharma | No | Yes | No | Yes | No |
| gpcr | receptor | DGIdb | No | Yes | No | Yes | No |
Page 1 of 7Next
Regulatory Interaction Network (13)
13 records.
| Source Protein Symbol | Source UniProt ID | Target Protein Symbol | Target UniProt ID | Is Directed | Is Stimulation | Is Inhibition | Database | References |
|---|---|---|---|---|---|---|---|---|
| EDNRB | P24530 | GNAS3 | O95467 | Yes | Yes | No | SIGNOR | SIGNOR:31160049 |
| EDNRB | P24530 | ALEX | P84996 | Yes | Yes | No | SIGNOR | SIGNOR:31160049 |
| EDNRB | P24530 | GNA14 | O95837 | Yes | Yes | No | WangSIGNOR | SIGNOR:31160049 |
Page 2 of 2Previous
Protein Complex Composition (2)
Isolation & Detection Technology (1)
1 record.
| EV Isolation Method | Detection Method | Number of References | References |
|---|---|---|---|
| Protein Organic Solvent Precipitation | Mass spectrometry | 1 | 32384937 |
Sequence, Structure & Domains12
Sequences
Length
442
Mass
49,644
Sequence
MQPPPSLCGRALVALVLACGLSRIWGEERGFPPDRATPLLQTAEIMTPPTKTLWPKGSNASLARSLAPAEVPKGDRTAGSPPRTISPPPCQGPIEIKETFKYINTVVSCLVFVLGIIGNSTLLRIIYKNKCMRNGPNILIASLALGDLLHIVIDIPINVYKLLAEDWPFGAEMCKLVPFIQKASVGITVLSLCALSIDRYRAVASWSRIKGIGVPKWTAVEIVLIWVVSVVLAVPEAIGFDIITMDYKGSYLRICLLHPVQKTAFMQFYKTAKDWWLFSFYFCLPLAITAFFYTLMTCEMLRKKSGMQIALNDHLKQRREVAKTVFCLVLVFALCWLPLHLSRILKLTLYNQNDPNRCELLSFLLVLDYIGINMASLNSCINPIALYLVSKRFKNCFKSCLCCWCQSFEEKQSLEEKQSCLKFKANDHGYDNFRSSNKYSSS
Alternative Products
Event=Alternative splicing; Named isoforms=3; Name=A; IsoId=P24530-1; Sequence=Displayed; Name=B; IsoId=P24530-2; Sequence=VSP_001879; Name=C; Synonyms=Delta-3; IsoId=P24530-3; Sequence=VSP_001878
Alternative Sequence
1; M -> MNKSTCLMAAETPSKRWRLHCLAFSQRFVRAGPACSSREACSSPRAGWNPAGFRLPGRWSPFVALHLVCQIREALKLRSGHRTPSGAGSSM (in isoform C); 399..442; SCLCCWCQSFEEKQSLEEKQSCLKFKANDHGYDNFRSSNKYSSS -> AGPHVGNKLVMLFSVNIECDGTVNQNPTMWPERKSNNN (in isoform B)
3D Structural Models
Turn
355..357
Helix
98..128; 130..132; 135..164; 170..204; 216..232; 234..239; 264..281; 283..310; 313..349; 358..389; 391..401
Beta Strand
206..208; 212..214; 240..247; 250..257; 352..354
3D Structure
Electron microscopy (10); X-ray crystallography (7)
Domain & Motif Annotations
Region
69..88; Disordered
Protein Families (3)
- G-protein coupled receptor 1 family
- Endothelin receptor subfamily
- EDNRB sub-subfamily
Sequence Similarities
Belongs to the G-protein coupled receptor 1 family. Endothelin receptor subfamily. EDNRB sub-subfamily.
Clinical Relevance6
Disease Involvement (6)
AlbinismDeafnessDisease variantFDA approved drug targetsHirschsprung diseaseWaardenburg syndrome
Related Diseases (10)
Biomarker
Discontinued in Phase 2; Approved; Phase 3; Phase 2; Phase 1/2
Drug Targets
FDA approved drug targets
Drugs (15)
Supporting Publications2
| PMID | Title | Abstract |
|---|---|---|
| 38731868 | The Deep Proteomics Approach Identified Extracellular Vesicular Proteins Correlated to Extracellular Matrix in Type One and Two Endometrial Cancer. | No abstract available |
| 40928027 | Familial Alzheimer's disease mutation identifies novel role of SORLA in release of neurotrophic exosomes. | No abstract available |