Protein detail

MYP0

Myelin protein P0 (Myelin peripheral protein) (MPP) (Myelin protein zero)

Entry name MYP0	UniProt ID P25189	EVMP confidence score 0.25
Supporting publications (n) 1	Transmembrane count 1	Protein classification Disease related genesHuman disease related genesPredicted intracellular proteinsPredicted membrane proteins

EVMP confidence score

Annotation confidence score; open for threshold definitions.

Extremely high >= 0.85High >= 0.70Medium >= 0.55Low >= 0.40

Basic Information13

Protein Names

Myelin protein P0 (Myelin peripheral protein) (MPP) (Myelin protein zero)

Protein Class (4)

Disease related genesHuman disease related genesPredicted intracellular proteinsPredicted membrane proteins

Protein Function (4)

Human disease related genes:Nervous system diseases:Neurodegenerative diseases
Disease related genes
Human disease related genes:Nervous system diseases:Other nervous and sensory system diseases
Predicted intracellular proteins

Transmembrane

154..179; Helical

Transmembrane Count

Ensembl

ENSG00000158887

Entrez Gene Symbol

MPZ

Gene Synonym (6)

CMT1CMT1BCMT2ICMT2JHMSNIBP0

Gene Description

Myelin protein zero

Chromosome

Position

161304735-161309968

Supporting publications (n)

EVMP confidence score

0.25

Fluorescence & Localization3

Cell SpecificNeutrophilsSecretome LocationIntracellular and membraneSecretome FunctionEnzyme

Function & Pathway7

Protein Function (4)

Human disease related genes:Nervous system diseases:Neurodegenerative diseases
Disease related genes
Human disease related genes:Nervous system diseases:Other nervous and sensory system diseases
Predicted intracellular proteins

Cellular Component (3)

Molecular Function

GO:0005198 structural molecule activity

Biological Process (3)

KEGG (2)

Reactome (2)

Mediation Categories

Adhesion and uptake mediation

Relations & Evidence39

Enzyme-Mediated Modification (4)

4 records.

Substrate Gene Symbol	Enzyme Gene Symbol	Enzyme UniProt ID	Residue Type	Residue Offset	Modification	Database	References
MPZ	PRKCB	P05771	S	210	phosphorylation	KEA	KEA:17570479
MPZ	PRKCB	P05771	S	228	phosphorylation	KEA	KEA:17570479
MPZ	PRKCB	P05771	S	233	phosphorylation	KEA	KEA:17570479
MPZ	PRKCB	P05771	S	243	phosphorylation	KEA	KEA:17570479

Ligand-Receptor Signaling (27)

27 records.

Category	Parent	Database	Transmitter	Receiver	Secreted	Plasma Membrane (Transmembrane)	Plasma Membrane (Peripheral)
cell_adhesion	cell_adhesion	OmniPath	Yes	Yes	No	Yes	No
transmembrane	transmembrane	UniProt_location	No	No	No	Yes	No
transmembrane	transmembrane	UniProt_topology	No	No	No	Yes	No
transmembrane	transmembrane	UniProt_keyword	No	No	No	Yes	No
transmembrane	transmembrane	TopDB	No	No	No	Yes	No
transmembrane	transmembrane	LOCATE	No	No	No	Yes	No
transmembrane	transmembrane	Ramilowski_location	No	No	No	Yes	No
transmembrane	transmembrane	OmniPath	No	No	No	Yes	No
plasma_membrane	plasma_membrane	UniProt_location	No	No	No	Yes	No
plasma_membrane	plasma_membrane	Cellinker	No	No	No	Yes	No

Page 2 of 3Previous Next

Regulatory Interaction Network (1)

1 record.

Source Protein Symbol	Source UniProt ID	Target Protein Symbol	Target UniProt ID	Is Directed	Is Stimulation	Is Inhibition	Database	References
PMP22	Q01453	MYP0	P25189	Yes	Yes	No	HPRDSPIKE_LCSIGNOR	SIGNOR:10212299 SPIKE_LC:16189514 HPRD:10212299

Protein Complex Composition (6)

6 records.

Component Gene Symbols	Component UniProt ID	Stoichiometry	Database	Database IDs
ALDH1A2 ALDH2 IFIH1 LGMN MPZL1 RMDN1	O94788 O95297 P05091 Q96DB5 Q99538 Q9BYX4	0:0:0:0:0:0	hu.MAP2
ALDH1A2 IFIH1 MPZL1	O94788 O95297 Q9BYX4	0:0:0	hu.MAP2
MPZL1	O95297	6	PDB	PDB:6igoPDB:6igt
MPZL1 PTPN11	O95297 Q06124	1:1	PDB	PDB:9mq5
MPZ	P25189	2	PDB	PDB:3oai
GCNT2 MPZL3 TMEM79	Q6UWV2 Q8N0V5 Q9BSE2	0:0:0	hu.MAP2

Isolation & Detection Technology (1)

1 record.

EV Isolation Method	Detection Method	Number of References	References
Differential UltracentrifugationSize Exclusion Chromatography	Western blottingELISA	2	38731868 26775013

Sequence, Structure & Domains13

Sequences

Length

248

Mass

27,555

Sequence

MAPGAPSSSPSPILAVLLFSSLVLSPAQAIVVYTDREVHGAVGSRVTLHCSFWSSEWVSDDISFTWRYQPEGGRDAISIFHYAKGQPYIDEVGTFKERIQWVGDPRWKDGSIVIHNLDYSDNGTFTCDVKNPPDIVGKTSQVTLYVFEKVPTRYGVVLGAVIGGVLGVVLLLLLLFYVVRYCWLRRQAALQRRLSAMEKGKLHKPGKDASKRGRQTPVLYAMLDHSRSTKAVSEKKAKGLGESRKDKK

Alternative Products

Event=Alternative splicing; Named isoforms=2; Name=1; IsoId=P25189-1; Sequence=Displayed; Name=L-MPZ; IsoId=P25189-2; Sequence=VSP_045844

Alternative Sequence

248; K -> KRLAGRAGDRGLGVESAKGPKVMVIEMELRKDEQSPELRPAVKSPSRTSLKNALKNMMGLNSDK (in isoform L-MPZ)

3D Structural Models

Turn

94..97

Helix

105..107; 119..121

Beta Strand

31..34; 36..41; 46..48; 50..53; 63..70; 77..83; 86..89; 91..93; 99..101; 112..114; 123..130; 138..148

3D Structure

X-ray crystallography (2)

Domain & Motif Annotations

Domain (FT)

30..143; Ig-like V-type

Region

224..248; Disordered

Protein Families

Myelin P0 protein family

Sequence Similarities

Belongs to the myelin P0 protein family.

Clinical Relevance2

Disease Involvement (6)

Charcot-Marie-Tooth diseaseDeafnessDejerine-Sottas syndromeDisease variantNeurodegenerationNeuropathy

Antibody

HPA068925

Supporting Publications1

PMID	Title	Abstract
38716512	Assessment of urine sample collection and processing variables for extracellular vesicle-based proteomics.	No abstract available