Protein detail
NKG2D
NKG2-D type II integral membrane protein (Killer cell lectin-like receptor subfamily K member 1) (NK cell receptor D) (NKG2-D-activating NK receptor) (CD antigen CD314)
Entry name NKG2D | UniProt ID | EVMP confidence score 0.50 |
Supporting publications (n) 5 | Transmembrane count 1 | Protein classification Cancer-related genesCD markersPredicted membrane proteinsTransporters |
EVMP confidence score
Annotation confidence score; open for threshold definitions.
Extremely high >= 0.85High >= 0.70Medium >= 0.55Low >= 0.40Basic Information13
Protein Names
NKG2-D type II integral membrane protein (Killer cell lectin-like receptor subfamily K member 1) (NK cell receptor D) (NKG2-D-activating NK receptor) (CD antigen CD314)
Protein Class (4)
Cancer-related genesCD markersPredicted membrane proteinsTransporters
Protein Function (3)
- Transporters:Transporter channels and pores
- Cancer-related genes:Candidate cancer biomarkers
- CD markers
Transmembrane
52..72; Helical; Signal-anchor for type II membrane protein
Transmembrane Count
1
Ensembl
Entrez Gene Symbol
Gene Synonym (5)
CD314D12S2489EKLRNKG2-DNKG2D
Gene Description
Killer cell lectin like receptor K1
Chromosome
12
Position
10372353-10391874
Supporting publications (n)
5
EVMP confidence score
0.50
Fluorescence & Localization3
Tissue SpecifickidneyCell SpecificEsophageal apical cellsBlood Cell Specificbasophil
Function & Pathway8
Protein Function (3)
- Transporters:Transporter channels and pores
- Cancer-related genes:Candidate cancer biomarkers
- CD markers
Cellular Component (4)
Molecular Function (6)
Biological Process (3)
Reactome (5)
Canonical Pathways (3)
- M1315 Sig pip3 signaling in b lymphocytes
- M8626 Sig bcr signaling pathway
- M10 Pid bcr 5pathway
Mediation Categories (5)
Adhesion and uptake mediationClinical-translation mediationFusion and delivery mediationImmune mediationReceptor-signaling mediation
Relations & Evidence52
Ligand-Receptor Signaling (49)
49 records.
| Category | Parent | Database | Transmitter | Receiver | Secreted | Plasma Membrane (Transmembrane) | Plasma Membrane (Peripheral) |
|---|---|---|---|---|---|---|---|
| other_receptor_family | receptor | HPMR | No | Yes | No | Yes | No |
| immune_cell | receptor | HPMR | No | Yes | No | Yes | No |
| killer_cell_lectin_like_receptor_immune_cell | receptor | HPMR | No | Yes | No | Yes | No |
| class_e | receptor | Surfaceome | No | Yes | No | Yes | No |
| scar | receptor | Surfaceome | No | Yes | No | Yes | No |
| hla_recognition | receptor | ICELLNET | No | Yes | No | Yes | No |
| receptor | receptor | OmniPath | No | Yes | No | Yes | No |
| extracellular | extracellular | HPMR | No | No | No | Yes | No |
| extracellular | extracellular | DGIdb | No | No | No | Yes | No |
| extracellular | extracellular | OmniPath | No | No | No | Yes | No |
Regulatory Interaction Network (1)
1 record.
| Source Protein Symbol | Source UniProt ID | Target Protein Symbol | Target UniProt ID | Is Directed | Is Stimulation | Is Inhibition | Database | References |
|---|---|---|---|---|---|---|---|---|
| ULBP2 | Q9BZM5 | NKG2D | P26718 | Yes | Yes | No | HPMRCellChatDBFantom5_LRdbCellTalkDBHPMR_LRdbiTALKtalklrRamilowski2015SIGNORconnectomeDB2020IntActWangLRdbHPMR_talklr | LRdb:10894171HPMR:10894171IntAct:28559451CellTalkDB:10894171CellChatDB:24223577IntAct:19424970connectomeDB2020:10894171connectomeDB2020:26041808SIGNOR:10894171 |
Protein Complex Composition (1)
Sequence, Structure & Domains9
Sequences
Length
216
Mass
25,304
Sequence
MGWIRGRRSRHSWEMSEFHNYNLDLKKSDFSTRWQKQRCPVVKSKCRENASPFFFCCFIAVAMGIRFIIMVTIWSAVFLNSLFNQEVQIPLTESYCGPCPKNWICYKNNCYQFFDESKNWYESQASCMSQNASLLKVYSKEDQDLLKLVKSYHWMGLVHIPTNGSWQWEDGSILSPNLLTIIEMQKGDCALYASSFKGYIENCSTPNTYICMQRTV
Alternative Products
Event=Alternative splicing; Named isoforms=1; Comment=A number of isoforms are produced.; Name=1; IsoId=P26718-1; Sequence=Displayed
3D Structural Models
Turn
129..131; 140..143; 161..163; 194..196
Helix
120..128; 144..148
Beta Strand
94..96; 103..106; 109..118; 133..135; 153..159; 166..168; 176..178; 180..182; 185..193; 197..201; 207..213
3D Structure
X-ray crystallography (8)
Domain & Motif Annotations
Domain (FT)
98..213; C-type lectin
Clinical Relevance6
Disease Involvement
Cancer-related genes
Related Diseases (6)
Biomarker
Phase 1; Phase 2; Discontinued in Phase 2
Drug Targets
Clinical trial target
Drugs (5)
Supporting Publications5
| PMID | Title | Abstract |
|---|---|---|
| 27601599 | Comprehensive Proteomic Analysis of Human Milk-derived Extracellular Vesicles Unveils a Novel Functional Proteome Distinct from Other Milk Components. | No abstract available |
| 31070281 | The Proteome of Pancreatic Cancer-Derived Exosomes Reveals Signatures Rich in Key Signaling Pathways. | No abstract available |
| 32396726 | Plasma-Derived Extracellular Vesicle Phosphoproteomics through Chemical Affinity Purification. | No abstract available |
| 38416841 | APOE from patient-derived astrocytic extracellular vesicles alleviates neuromyelitis optica spectrum disorder in a mouse model. | No abstract available |
| 40740986 | Proteomics analysis reveals elevated RAB21 in serum-derived extracellular vesicles from patients with follicular thyroid carcinoma. | No abstract available |