Protein detail
NMBR
Neuromedin-B receptor (NMB-R) (Epididymis tissue protein Li 185a) (Neuromedin-B-preferring bombesin receptor)
Entry name NMBR | UniProt ID | EVMP confidence score 0.50 |
Supporting publications (n) 1 | Transmembrane count 7 | Protein classification |
EVMP confidence score
Annotation confidence score; open for threshold definitions.
Extremely high >= 0.85High >= 0.70Medium >= 0.55Low >= 0.40Basic Information8
Protein Names
Neuromedin-B receptor (NMB-R) (Epididymis tissue protein Li 185a) (Neuromedin-B-preferring bombesin receptor)
Protein Function
G-protein coupled receptors:GPCRs excl olfactory receptors
Transmembrane
42..65; Helical; Name=1; 80..99; Helical; Name=2; 118..139; Helical; Name=3; 157..177; Helical; Name=4; 212..235; Helical; Name=5; 267..287; Helical; Name=6; 300..327; Helical; Name=7
Transmembrane Count
7
Ensembl
Entrez Gene Symbol
Supporting publications (n)
1
EVMP confidence score
0.50
Fluorescence & Localization2
Cell SpecificLate spermatids
Function & Pathway8
Protein Function
G-protein coupled receptors:GPCRs excl olfactory receptors
Cellular Component (2)
Molecular Function (2)
Biological Process (3)
Reactome (5)
Canonical Pathways (2)
- M110 Pid il1 pathway
- M54 Pid il12 2pathway
Mediation Categories (2)
Immune mediationReceptor-signaling mediation
Relations & Evidence71
Ligand-Receptor Signaling (56)
56 records.
| Category | Parent | Database | Transmitter | Receiver | Secreted | Plasma Membrane (Transmembrane) | Plasma Membrane (Peripheral) |
|---|---|---|---|---|---|---|---|
| class_a_rhodopsin_peptide | receptor | GPCRdb | No | Yes | No | Yes | No |
| class_a_rhodopsin_peptide_bombesin | receptor | GPCRdb | No | Yes | No | Yes | No |
| receptor | receptor | OmniPath | No | Yes | No | Yes | No |
| extracellular | extracellular | HPMR | No | No | No | Yes | No |
| extracellular | extracellular | OmniPath | No | No | No | Yes | No |
| intracellular | intracellular | ComPPI | No | No | No | Yes | No |
| intracellular | intracellular | GO_Intercell | No | No | No | Yes | No |
| intracellular | intracellular | OmniPath | No | No | No | Yes | No |
| transmembrane | transmembrane | UniProt_location | No | No | No | Yes | No |
| transmembrane | transmembrane | UniProt_topology | No | No | No | Yes | No |
Regulatory Interaction Network (14)
14 records.
Page 1 of 2Next
Isolation & Detection Technology (1)
1 record.
| EV Isolation Method | Detection Method | Number of References | References |
|---|---|---|---|
| Differential UltracentrifugationUltrafiltration / Tangential Flow FiltrationSize Exclusion ChromatographyImmunoaffinity Capture | Mass spectrometry | 19 | 23161513283698484121688433035814397661583639856437786918381689064074865828986585278941043832153539569406319433653370951032795414231615133095018528789823 |
Sequence, Structure & Domains10
Sequences
Length
390
Mass
43,435
Sequence
MPSKSLSNLSVTTGANESGSVPEGWERDFLPASDGTTTELVIRCVIPSLYLLIITVGLLGNIMLVKIFITNSAMRSVPNIFISNLAAGDLLLLLTCVPVDASRYFFDEWMFGKVGCKLIPVIQLTSVGVSVFTLTALSADRYRAIVNPMDMQTSGALLRTCVKAMGIWVVSVLLAVPEAVFSEVARISSLDNSSFTACIPYPQTDELHPKIHSVLIFLVYFLIPLAIISIYYYHIAKTLIKSAHNLPGEYNEHTKKQMETRKRLAKIVLVFVGCFIFCWFPNHILYMYRSFNYNEIDPSLGHMIVTLVARVLSFGNSCVNPFALYLLSESFRRHFNSQLCCGRKSYQERGTSYLLSSSAVRMTSLKSNAKNMVTNSVLLNGHSMKQEMAL
3D Structural Models
Helix
40..69; 80..105; 113..146; 156..173; 177..180; 207..220; 222..243; 257..291; 300..313; 316..327; 330..341
Beta Strand
72..74; 183..186; 196..201; 293..295
3D Structure
Electron microscopy (2)
Domain & Motif Annotations
Compositional Bias
1..19; Polar residues
Region
1..22; Disordered
Protein Families
G-protein coupled receptor 1 family
Sequence Similarities
Belongs to the G-protein coupled receptor 1 family.
Supporting Publications1
| PMID | Title | Abstract |
|---|---|---|
| 33749657 | Changes in the Morphology, Number, and Protein Levels of Plasma Exosomes in CADASIL Patients. | In addition, CADASIL plasma exosomes had significantly lower levels of NOTCH3 and significantly increased levels of NFL than those of matched healthy subjects. In addition, NOTCH3, Neurofilament light and Aβ42 levels in plasma exosomes were quantified by enzyme-linked immunosorbent assays. In addition, plasma exosome NOTCH3 and NFL levels may act as biomarkers to monitor and predict disease progression and measure therapeutic effectiveness in the future clinical trials. Interestingly, plasma exosome NOTCH3 levels of CADASIL patients significantly correlated with severity of WMLs. The exosome NOTCH3 may be related to the pathological changes of CADASIL, which provides a basis for the pathogenesis research of CADASIL. |