Protein detail

NMBR

Neuromedin-B receptor (NMB-R) (Epididymis tissue protein Li 185a) (Neuromedin-B-preferring bombesin receptor)

Entry name NMBR	UniProt ID P28336	EVMP confidence score 0.40
Supporting publications (n) 1	Transmembrane count 7	Protein classification

Basic Information

Protein Names

Neuromedin-B receptor (NMB-R) (Epididymis tissue protein Li 185a) (Neuromedin-B-preferring bombesin receptor)

Protein Function

G-protein coupled receptors:GPCRs excl olfactory receptors

Transmembrane

42..65; Helical; Name=1; 80..99; Helical; Name=2; 118..139; Helical; Name=3; 157..177; Helical; Name=4; 212..235; Helical; Name=5; 267..287; Helical; Name=6; 300..327; Helical; Name=7

Transmembrane Count

Ensembl

ENSG00000135577

Entrez Gene Symbol

NMBR

Supporting publications (n)

EVMP confidence score

0.40

Fluorescence & Localization

Cell SpecificLate spermatids

Function & Pathway

Protein Function

G-protein coupled receptors:GPCRs excl olfactory receptors

Cellular Component (2)

Molecular Function (2)

Biological Process (3)

KEGG

hsa04080 Neuroactive ligand-receptor interaction

Reactome (5)

Canonical Pathways (2)

M110 Pid il1 pathway
M54 Pid il12 2pathway

Mediation Categories (2)

Immune mediationReceptor-signaling mediation

Relations & Evidence71

Ligand-Receptor Signaling (56)

56 records.

Category	Parent	Database	Plasma Membrane (Transmembrane)
transmembrane	transmembrane	UniProt_keyword	Yes
transmembrane	transmembrane	GO_Intercell	Yes
transmembrane	transmembrane	CellPhoneDB	Yes
transmembrane	transmembrane	TopDB	Yes
transmembrane	transmembrane	Ramilowski_location	Yes
transmembrane	transmembrane	OmniPath	Yes
plasma_membrane	plasma_membrane	UniProt_location	Yes
plasma_membrane	plasma_membrane	Cellinker	Yes
plasma_membrane	plasma_membrane	OmniPath	Yes
plasma_membrane_transmembrane	plasma_membrane_transmembrane	HPMR	Yes

Page 4 of 6Previous Next

Regulatory Interaction Network (14)

14 records.

Source Protein Symbol	Source UniProt ID	Target Protein Symbol	Target UniProt ID	Is Directed	Is Stimulation	Database	References
NMB	P08949	NMBR	P28336	Yes	Yes	iTALKGuide2Pharma_LRdbICELLNETSIGNORHINTHPMR_talklrHPMRCellChatDBHPRD_LRdbtalklrscConnectHPRDGuide2Pharma_CellinkerWangRamilowski2015HPMR_LRdbCellPhoneDBGuide2Pharma_talklrHPRD_talklrCellinkerSTRING_talklrGuide2PharmaCellTalkDBFantom5_LRdbHPMR_CellinkerconnectomeDB2020LRdb	LRdb:10544247 LRdb:15169928 HPRD:8253343 HPRD:10544247 Cellinker:15169928 SIGNOR:11313903 connectomeDB2020:7838118 Cellinker:8392057 Cellinker:10454496 LRdb:7838118 connectomeDB2020:15169928 Guide2Pharma:25976083 Cellinker:8253343 Guide2Pharma:18055507 LRdb:8253343 connectomeDB2020:10454496 Cellinker:10544247 CellTalkDB:10544247 Guide2Pharma:21729729 HPMR:15169928 connectomeDB2020:8253343 HPRD:8392057 scConnect:18055507 ICELLNET:1655761 Cellinker:7838118 LRdb:10454496 HINT:8392057 connectomeDB2020:10544247 scConnect:25976083 LRdb:8392057 scConnect:21729729 connectomeDB2020:8392057
NMBR	P28336	GNAI3	P08754	Yes	Yes	SIGNOR	SIGNOR:31160049
NMBR	P28336	GNAQ	P50148	Yes	Yes	SIGNOR	SIGNOR:8026589 SIGNOR:31160049
NMBR	P28336	GNAS3	O95467	Yes	Yes	SIGNOR	SIGNOR:31160049
NMBR	P28336	ALEX	P84996	Yes	Yes	SIGNOR	SIGNOR:31160049
NMBR	P28336	GNAL	P38405	Yes	Yes	SIGNOR	SIGNOR:31160049
NMBR	P28336	GNAS2	P63092	Yes	Yes	SIGNOR	SIGNOR:31160049
NMBR	P28336	GNAS1	Q5JWF2	Yes	Yes	SIGNOR	SIGNOR:31160049
NMBR	P28336	GNAI1	P63096	Yes	Yes	SIGNOR	SIGNOR:31160049
NMBR	P28336	GNA12	Q03113	Yes	Yes	SIGNOR	SIGNOR:11313903

Page 1 of 2Next

Isolation & Detection Technology (1)

1 record.

EV Isolation Method	Detection Method	Number of References	References
Differential UltracentrifugationUltrafiltration / Tangential Flow FiltrationSize Exclusion ChromatographyImmunoaffinity Capture	Mass spectrometry	19	23161513 28369848 41216884 33035814 39766158 36398564 37786918 38168906 40748658 28986585 27894104 38321535 39569406 31943365 33709510 32795414 23161513 30950185 28789823

Sequence, Structure & Domains

Sequences

Length

390

Mass

43,435

Sequence

MPSKSLSNLSVTTGANESGSVPEGWERDFLPASDGTTTELVIRCVIPSLYLLIITVGLLGNIMLVKIFITNSAMRSVPNIFISNLAAGDLLLLLTCVPVDASRYFFDEWMFGKVGCKLIPVIQLTSVGVSVFTLTALSADRYRAIVNPMDMQTSGALLRTCVKAMGIWVVSVLLAVPEAVFSEVARISSLDNSSFTACIPYPQTDELHPKIHSVLIFLVYFLIPLAIISIYYYHIAKTLIKSAHNLPGEYNEHTKKQMETRKRLAKIVLVFVGCFIFCWFPNHILYMYRSFNYNEIDPSLGHMIVTLVARVLSFGNSCVNPFALYLLSESFRRHFNSQLCCGRKSYQERGTSYLLSSSAVRMTSLKSNAKNMVTNSVLLNGHSMKQEMAL

3D Structural Models

Helix

40..69; 80..105; 113..146; 156..173; 177..180; 207..220; 222..243; 257..291; 300..313; 316..327; 330..341

Beta Strand

72..74; 183..186; 196..201; 293..295

3D Structure

Electron microscopy (2)

Domain & Motif Annotations

Compositional Bias

1..19; Polar residues

Region

1..22; Disordered

Protein Families

G-protein coupled receptor 1 family

Sequence Similarities

Belongs to the G-protein coupled receptor 1 family.

Supporting Publications1

PMID	Title	Related sentences
33749657	Changes in the Morphology, Number, and Protein Levels of Plasma Exosomes in CADASIL Patients.	In addition, CADASIL plasma exosomes had significantly lower levels of NOTCH3 and significantly increased levels of NFL than those of matched healthy subjects. In addition, NOTCH3, Neurofilament light and Aβ42 levels in plasma exosomes were quantified by enzyme-linked immunosorbent assays. In addition, plasma exosome NOTCH3 and NFL levels may act as biomarkers to monitor and predict disease progression and measure therapeutic effectiveness in the future clinical trials. Interestingly, plasma exosome NOTCH3 levels of CADASIL patients significantly correlated with severity of WMLs. The exosome NOTCH3 may be related to the pathological changes of CADASIL, which provides a basis for the pathogenesis research of CADASIL.