Protein detail

NMBR

Neuromedin-B receptor (NMB-R) (Epididymis tissue protein Li 185a) (Neuromedin-B-preferring bombesin receptor)

Entry name NMBR	UniProt ID P28336	EVMP score 0.50
Frequency 1	Transmembrane count 7	Protein classification

EVMP score: annotation confidence score.

Extremely high >= 0.85High >= 0.70Medium >= 0.55Low >= 0.40

Basic Information

Protein Names

Neuromedin-B receptor (NMB-R) (Epididymis tissue protein Li 185a) (Neuromedin-B-preferring bombesin receptor)

Protein Function

G-protein coupled receptors:GPCRs excl olfactory receptors

Transmembrane

42..65; Helical; Name=1; 80..99; Helical; Name=2; 118..139; Helical; Name=3; 157..177; Helical; Name=4; 212..235; Helical; Name=5; 267..287; Helical; Name=6; 300..327; Helical; Name=7

Transmembrane Count

Ensembl

ENSG00000135577

Entrez Gene Symbol

NMBR

Frequency

EVMP Score

0.50

Fluorescence & Localization

Cell SpecificLate spermatids

Function & Pathway

Protein Function

G-protein coupled receptors:GPCRs excl olfactory receptors

Cellular Component

Molecular Function

Biological Process

KEGG

hsa04080 Neuroactive ligand-receptor interaction

Reactome

Canonical Pathways

M110 Pid il1 pathway
M54 Pid il12 2pathway

Mediation Categories

Immune mediationReceptor-signaling mediation

Relations & Evidence

Enzyme-Mediated Modification

0 records.

Ligand-Receptor Signaling

56 records.

Category	Parent	Database	Transmitter	Receiver	Secreted	Plasma Membrane (Transmembrane)	Plasma Membrane (Peripheral)
class_a_rhodopsin_peptide	receptor	GPCRdb	No	Yes	No	Yes	No
class_a_rhodopsin_peptide_bombesin	receptor	GPCRdb	No	Yes	No	Yes	No
receptor	receptor	OmniPath	No	Yes	No	Yes	No
extracellular	extracellular	HPMR	No	No	No	Yes	No
extracellular	extracellular	OmniPath	No	No	No	Yes	No
intracellular	intracellular	ComPPI	No	No	No	Yes	No
intracellular	intracellular	GO_Intercell	No	No	No	Yes	No
intracellular	intracellular	OmniPath	No	No	No	Yes	No
transmembrane	transmembrane	UniProt_location	No	No	No	Yes	No
transmembrane	transmembrane	UniProt_topology	No	No	No	Yes	No

Page 3 of 6Previous Next

Regulatory Interaction Network

14 records.

Source Protein Symbol	Source UniProt ID	Target Protein Symbol	Target UniProt ID	Is Directed	Is Stimulation	Is Inhibition	Database	References
NMBR	P28336	GNAO	P09471	Yes	Yes	No	SIGNOR	SIGNOR:31160049
NMBR	P28336	GNA14	O95837	Yes	Yes	No	SIGNOR	SIGNOR:31160049
NMBR	P28336	GNA13	Q14344	Yes	Yes	No	SIGNOR	SIGNOR:11313903
NMBR	P28336	GNAZ	P19086	Yes	Yes	No	SIGNOR	SIGNOR:31160049

Page 2 of 2Previous

Protein Complex Composition

0 records.

Isolation & Detection Technology

1 record.

EV Isolation Method	Detection Method	Number of References	References
Differential UltracentrifugationUltrafiltration / Tangential Flow FiltrationSize Exclusion ChromatographyImmunoaffinity Capture	Mass spectrometry	19	23161513 28369848 41216884 33035814 39766158 36398564 37786918 38168906 40748658 28986585 27894104 38321535 39569406 31943365 33709510 32795414 23161513 30950185 28789823

Sequence, Structure & Domains

Sequences

Length

390

Mass

43,435

Sequence

MPSKSLSNLSVTTGANESGSVPEGWERDFLPASDGTTTELVIRCVIPSLYLLIITVGLLGNIMLVKIFITNSAMRSVPNIFISNLAAGDLLLLLTCVPVDASRYFFDEWMFGKVGCKLIPVIQLTSVGVSVFTLTALSADRYRAIVNPMDMQTSGALLRTCVKAMGIWVVSVLLAVPEAVFSEVARISSLDNSSFTACIPYPQTDELHPKIHSVLIFLVYFLIPLAIISIYYYHIAKTLIKSAHNLPGEYNEHTKKQMETRKRLAKIVLVFVGCFIFCWFPNHILYMYRSFNYNEIDPSLGHMIVTLVARVLSFGNSCVNPFALYLLSESFRRHFNSQLCCGRKSYQERGTSYLLSSSAVRMTSLKSNAKNMVTNSVLLNGHSMKQEMAL

3D Structural Models

Helix

40..69; 80..105; 113..146; 156..173; 177..180; 207..220; 222..243; 257..291; 300..313; 316..327; 330..341

Beta Strand

72..74; 183..186; 196..201; 293..295

3D Structure

Electron microscopy (2)

Domain & Motif Annotations

Compositional Bias

1..19; Polar residues

Region

1..22; Disordered

Protein Families

G-protein coupled receptor 1 family

Sequence Similarities

Belongs to the G-protein coupled receptor 1 family.

Clinical Relevance