Protein detail
NMBR
Neuromedin-B receptor (NMB-R) (Epididymis tissue protein Li 185a) (Neuromedin-B-preferring bombesin receptor)
Entry name NMBR | UniProt ID | EVMP score 0.50 |
Frequency 1 | Transmembrane count 7 | Protein classification |
EVMP score: annotation confidence score.
Extremely high >= 0.85High >= 0.70Medium >= 0.55Low >= 0.40
Basic Information
Protein Names
Neuromedin-B receptor (NMB-R) (Epididymis tissue protein Li 185a) (Neuromedin-B-preferring bombesin receptor)
Protein Function
G-protein coupled receptors:GPCRs excl olfactory receptors
Transmembrane
42..65; Helical; Name=1; 80..99; Helical; Name=2; 118..139; Helical; Name=3; 157..177; Helical; Name=4; 212..235; Helical; Name=5; 267..287; Helical; Name=6; 300..327; Helical; Name=7
Transmembrane Count
7
Ensembl
Entrez Gene Symbol
Frequency
1
EVMP Score
0.50
Fluorescence & Localization
Cell SpecificLate spermatids
Function & Pathway
Protein Function
G-protein coupled receptors:GPCRs excl olfactory receptors
Cellular Component
Biological Process
Reactome
Canonical Pathways
- M110 Pid il1 pathway
- M54 Pid il12 2pathway
Mediation Categories
Immune mediationReceptor-signaling mediation
Relations & Evidence
Enzyme-Mediated Modification
0 records.
Ligand-Receptor Signaling
56 records.
| Category | Parent | Database | Transmitter | Receiver | Secreted | Plasma Membrane (Transmembrane) | Plasma Membrane (Peripheral) |
|---|---|---|---|---|---|---|---|
| class_a_rhodopsin_peptide | receptor | GPCRdb | No | Yes | No | Yes | No |
| class_a_rhodopsin_peptide_bombesin | receptor | GPCRdb | No | Yes | No | Yes | No |
| receptor | receptor | OmniPath | No | Yes | No | Yes | No |
| extracellular | extracellular | HPMR | No | No | No | Yes | No |
| extracellular | extracellular | OmniPath | No | No | No | Yes | No |
| intracellular | intracellular | ComPPI | No | No | No | Yes | No |
| intracellular | intracellular | GO_Intercell | No | No | No | Yes | No |
| intracellular | intracellular | OmniPath | No | No | No | Yes | No |
| transmembrane | transmembrane | UniProt_location | No | No | No | Yes | No |
| transmembrane | transmembrane | UniProt_topology | No | No | No | Yes | No |
Regulatory Interaction Network
14 records.
| Source Protein Symbol | Source UniProt ID | Target Protein Symbol | Target UniProt ID | Is Directed | Is Stimulation | Is Inhibition | Database | References |
|---|---|---|---|---|---|---|---|---|
| NMBR | P28336 | GNAO | P09471 | Yes | Yes | No | SIGNOR | SIGNOR:31160049 |
| NMBR | P28336 | GNA14 | O95837 | Yes | Yes | No | SIGNOR | SIGNOR:31160049 |
| NMBR | P28336 | GNA13 | Q14344 | Yes | Yes | No | SIGNOR | SIGNOR:11313903 |
| NMBR | P28336 | GNAZ | P19086 | Yes | Yes | No | SIGNOR | SIGNOR:31160049 |
Page 2 of 2Previous
Protein Complex Composition
0 records.
Isolation & Detection Technology
1 record.
| EV Isolation Method | Detection Method | Number of References | References |
|---|---|---|---|
| Differential UltracentrifugationUltrafiltration / Tangential Flow FiltrationSize Exclusion ChromatographyImmunoaffinity Capture | Mass spectrometry | 19 | 23161513283698484121688433035814397661583639856437786918381689064074865828986585278941043832153539569406319433653370951032795414231615133095018528789823 |
Sequence, Structure & Domains
Sequences
Length
390
Mass
43,435
Sequence
MPSKSLSNLSVTTGANESGSVPEGWERDFLPASDGTTTELVIRCVIPSLYLLIITVGLLGNIMLVKIFITNSAMRSVPNIFISNLAAGDLLLLLTCVPVDASRYFFDEWMFGKVGCKLIPVIQLTSVGVSVFTLTALSADRYRAIVNPMDMQTSGALLRTCVKAMGIWVVSVLLAVPEAVFSEVARISSLDNSSFTACIPYPQTDELHPKIHSVLIFLVYFLIPLAIISIYYYHIAKTLIKSAHNLPGEYNEHTKKQMETRKRLAKIVLVFVGCFIFCWFPNHILYMYRSFNYNEIDPSLGHMIVTLVARVLSFGNSCVNPFALYLLSESFRRHFNSQLCCGRKSYQERGTSYLLSSSAVRMTSLKSNAKNMVTNSVLLNGHSMKQEMAL
3D Structural Models
Helix
40..69; 80..105; 113..146; 156..173; 177..180; 207..220; 222..243; 257..291; 300..313; 316..327; 330..341
Beta Strand
72..74; 183..186; 196..201; 293..295
3D Structure
Electron microscopy (2)
Domain & Motif Annotations
Compositional Bias
1..19; Polar residues
Region
1..22; Disordered
Protein Families
G-protein coupled receptor 1 family
Sequence Similarities
Belongs to the G-protein coupled receptor 1 family.