Protein detail
CD34
Hematopoietic progenitor cell antigen CD34 (CD antigen CD34)
Entry name CD34 | UniProt ID | EVMP confidence score 0.50 |
Supporting publications (n) 4 | Transmembrane count 1 | Protein classification CD markersPredicted membrane proteins |
EVMP confidence score
Annotation confidence score; open for threshold definitions.
Extremely high >= 0.85High >= 0.70Medium >= 0.55Low >= 0.40Basic Information12
Protein Names
Hematopoietic progenitor cell antigen CD34 (CD antigen CD34)
Protein Class (2)
CD markersPredicted membrane proteins
Protein Function
CD markers
Transmembrane
291..311; Helical
Transmembrane Count
1
Ensembl
Entrez Gene Symbol
Gene Description
CD34 molecule
Chromosome
1
Position
207880972-207911402
Supporting publications (n)
4
EVMP confidence score
0.50
Fluorescence & Localization3
Tissue Specificbone marrowCell SpecificErythrocyte progenitors
Function & Pathway7
Protein Function
CD markers
Cellular Component (10)
- GO:0005576 extracellular region
- GO:0005737 cytoplasm
- GO:0005764 lysosome
- GO:0005886 plasma membrane
- GO:0009897 external side of plasma membrane
- GO:0009925 basal plasma membrane
- GO:0016324 apical plasma membrane
- GO:0036053 glomerular endothelium fenestra
- GO:0045171 intercellular bridge
- GO:0048471 perinuclear region of cytoplasm
Molecular Function (4)
Biological Process (3)
Reactome (2)
Mediation Categories (5)
Adhesion and uptake mediationClinical-translation mediationFusion and delivery mediationImmune mediationReceptor-signaling mediation
Relations & Evidence48
Ligand-Receptor Signaling (47)
47 records.
| Category | Parent | Database | Transmitter | Receiver | Secreted | Plasma Membrane (Transmembrane) | Plasma Membrane (Peripheral) |
|---|---|---|---|---|---|---|---|
| cell_surface | cell_surface | Surfaceome | No | No | No | Yes | No |
| cell_surface | cell_surface | connectomeDB2020 | No | No | No | Yes | No |
| cell_surface | cell_surface | Baccin2019 | No | No | No | Yes | No |
| cell_surface | cell_surface | OmniPath | No | No | No | Yes | No |
| ligand | ligand | talklr | Yes | No | No | Yes | No |
| ligand | ligand | iTALK | Yes | No | No | Yes | No |
| ligand | ligand | EMBRACE | Yes | No | No | Yes | No |
| ligand | ligand | ICELLNET | Yes | No | No | Yes | No |
| ligand | ligand | CellTalkDB | Yes | No | No | Yes | No |
| ligand | ligand | Ramilowski2015 | Yes | No | No | Yes | No |
Isolation & Detection Technology (1)
1 record.
| EV Isolation Method | Detection Method | Number of References | References |
|---|---|---|---|
| Mass spectrometry | 0 |
Sequence, Structure & Domains9
Sequences
Length
385
Mass
40,716
Sequence
MLVRRGARAGPRMPRGWTALCLLSLLPSGFMSLDNNGTATPELPTQGTFSNVSTNVSYQETTTPSTLGSTSLHPVSQHGNEATTNITETTVKFTSTSVITSVYGNTNSSVQSQTSVISTVFTTPANVSTPETTLKPSLSPGNVSDLSTTSTSLATSPTKPYTSSSPILSDIKAEIKCSGIREVKLTQGICLEQNKTSSCAEFKKDRGEGLARVLCGEEQADADAGAQVCSLLLAQSEVRPQCLLLVLANRTEISSKLQLMKKHQSDLKKLGILDFTEQDVASHQSYSQKTLIALVTSGALLAVLGITGYFLMNRRSWSPTGERLGEDPYYTENGGGQGYSSGPGTSPEAQGKASVNRGAQENGTGQATSRNGHSARQHVVADTEL
Alternative Products
Event=Alternative splicing; Named isoforms=2; Comment=Both isoforms are expressed on the cell surface. CD34-T/CD34-F ratio increases with cell differentiation.; Name=CD34-F; IsoId=P28906-1; Sequence=Displayed; Name=CD34-T; IsoId=P28906-2; Sequence=VSP_004159, VSP_004160
Alternative Sequence
325..328; GEDP -> ELEP (in isoform CD34-T); 329..385; Missing (in isoform CD34-T)
Domain & Motif Annotations
Compositional Bias
127..142; Polar residues; 144..159; Low complexity; 357..374; Polar residues
Region
127..159; Disordered; 321..385; Disordered
Protein Families
CD34 family
Sequence Similarities
Belongs to the CD34 family.
Clinical Relevance4
Related Diseases (3)
Biomarker
Phase 1; Phase 2
Drugs (10)
Supporting Publications4
| PMID | Title | Abstract |
|---|---|---|
| 21835908 | Exosomes from human CD34(+) stem cells mediate their proangiogenic paracrine activity. | CD34(+) exosomes may represent a significant component of the paracrine effect of progenitor cell transplantation for therapeutic angiogenesis. CONCLUSIONS: Our data demonstrate that human CD34(+) cells secrete exosomes that have independent angiogenic activity both in vitro and in vivo. In vitro, CD34(+) exosomes replicated the angiogenic activity of CD34(+) cells by increasing endothelial cell viability, proliferation, and tube formation on Matrigel. In vivo, the CD34(+) exosomes stimulated angiogenesis in Matrigel plug and corneal assays. Interestingly, exosomes from CD34(+) cells but not from CD34(+) cell-depleted mononuclear cells had angiogenic activity. METHODS AND RESULTS: Exosomes collected from the conditioned media of mobilized human CD34(+) cells had the characteristic size (40 to 90 nm; determined by dynamic light scattering), cup-shaped morphology (electron microscopy), expressed exosome-marker proteins CD63, phosphatidylserine (flow cytometry) and TSG101 (immunoblotting), besides expressing CD34(+) cell lineage marker protein, CD34. OBJECTIVE: Our objective was to investigate the mechanism of CD34(+) stem cell-induced proangiogenic paracrine effects and to examine if exosomes, a component of paracrine secretion, are involved. |
| 38173016 | Extracellular vesicle-derived TP53BP1, CD34, and PBX1 from human peripheral blood serve as potential biomarkers for the assessment and prediction of vascular aging. | No abstract available |
| 38762017 | Preliminary study on the mechanism by which exosomes derived from human exfoliated deciduous teeth improve the proliferation and osteogenic inhibitory effect of glucocorticoid-induced BMSCs. | In conclusion, SHED-derived exosomes partially reversed the inhibitory effects of glucocorticoids on BMSC proliferation and osteogenesis by inhibiting the expression of HGF, ITGB8 and IL7, and upregulating the expression of EFNA1. Transcriptome sequencing analysis revealed that the differentially expressed mRNAs regulated by SHED-derived exosomes were enriched mainly in signaling pathways such as the apoptosis pathway, the PI3K-Akt signaling pathway, the Hippo signaling pathway and the p53 signaling pathway. |
| 39166055 | Dental pulp stem cells regenerate neural tissue in degenerative disorders and stroke rehabilitation: A scope systematic review. | DPSC-derived exosomes suppressed the expression of IL-6, IL-1β, TNF-α, and TGF, key mediators of nerve tissue inflammation. |