Protein detail
PEBP1
Phosphatidylethanolamine-binding protein 1 (PEBP-1) (HCNPpp) (Neuropolypeptide h3) (Prostatic-binding protein) (Raf kinase inhibitor protein) (RKIP) [Cleaved into: Hippocampal cholinergic neurostimulating peptide (HCNP)]
Entry name PEBP1 | UniProt ID | EVMP confidence score 0.75 |
Supporting publications (n) 36 | Transmembrane count | Protein classification Plasma proteinsPredicted intracellular proteins |
EVMP confidence score
Annotation confidence score; open for threshold definitions.
Extremely high >= 0.85High >= 0.70Medium >= 0.55Low >= 0.40Basic Information11
Protein Names
Phosphatidylethanolamine-binding protein 1 (PEBP-1) (HCNPpp) (Neuropolypeptide h3) (Prostatic-binding protein) (Raf kinase inhibitor protein) (RKIP) [Cleaved into: Hippocampal cholinergic neurostimulating peptide (HCNP)]
Protein Class (2)
Plasma proteinsPredicted intracellular proteins
Protein Function
Predicted intracellular proteins
Ensembl
Entrez Gene Symbol
Gene Synonym (4)
HCNPPBPPEBPRKIP
Gene Description
Phosphatidylethanolamine binding protein 1
Chromosome
12
Position
118136124-118145584
Supporting publications (n)
36
EVMP confidence score
0.75
Fluorescence & Localization3
Tissue SpecificbrainCell SpecificAstrocytes
Function & Pathway6
Protein Function
Predicted intracellular proteins
Cellular Component (3)
Molecular Function (7)
Biological Process (3)
Reactome (8)
- R-hsa-5663202 diseases of signal transduction by growth factor receptors and second messengers
- R-hsa-5674135 map2k and mapk activation
- R-hsa-5684996 mapk1 mapk3 signaling
- R-hsa-5683057 mapk family signaling cascades
- R-hsa-5675221 negative regulation of mapk pathway
- R-hsa-6802957 oncogenic mapk signaling
- R-hsa-6802952 signaling by braf and raf1 fusions
- R-hsa-6802946 signaling by moderate kinase activity braf mutants
Mediation Categories (2)
Clinical-translation mediationReceptor-signaling mediation
Relations & Evidence31
Enzyme-Mediated Modification (8)
8 records.
| Substrate Gene Symbol | Enzyme Gene Symbol | Enzyme UniProt ID | Residue Type | Residue Offset | Modification | Database | References |
|---|---|---|---|---|---|---|---|
| PEBP1 | PRKCA | P17252 | S | 153 | phosphorylation | PhosphoNetworksphosphoELM_MIMPPhosphoSite_MIMPMIMPHPRD_MIMPProtMapperHPRDKEAphosphoELMPhosphoSitePhosphoSite_ProtMapper | HPRD:14654844HPRD:12551925HPRD:20068231KEA:12551925phosphoELM:14654844KEA:14654844HPRD:20166139 |
| PEBP1 | PRKCD | Q05655 | S | 153 | phosphorylation | phosphoELM_MIMPPhosphoSite_MIMPMIMPHPRD_MIMPSIGNORProtMapperHPRDKEAphosphoELMSIGNOR_ProtMapperPhosphoSitePhosphoSite_ProtMapper | HPRD:14654844SIGNOR:14654844HPRD:12551925HPRD:20068231KEA:12551925ProtMapper:14654844phosphoELM:14654844KEA:14654844HPRD:20166139 |
| PEBP1 | PRKCD | Q05655 | T | 51 | phosphorylation | PhosphoNetworks | |
| PEBP1 | PRKCG | P05129 | S | 153 | phosphorylation | phosphoELM_MIMPPhosphoSite_MIMPMIMPHPRD_MIMPSIGNORProtMapperHPRDKEASIGNOR_ProtMapper | HPRD:14654844ProtMapper:12551925SIGNOR:12551925HPRD:12551925HPRD:20068231KEA:12551925KEA:14654844HPRD:20166139 |
| PEBP1 | PRKCB | P05771 | S | 153 | phosphorylation | phosphoELM_MIMPPhosphoSite_MIMPMIMPHPRD_MIMPHPRDKEA | HPRD:14654844HPRD:12551925HPRD:20068231KEA:12551925KEA:14654844HPRD:20166139 |
| PEBP1 | PRKCZ | Q05513 | S | 153 | phosphorylation | phosphoELM_MIMPPhosphoSite_MIMPMIMPNCI-PID_ProtMapperHPRD_MIMPProtMapperHPRDKEA | HPRD:14654844ProtMapper:12551925HPRD:12551925HPRD:20068231KEA:12551925ProtMapper:10891480KEA:14654844HPRD:20166139 |
| PEBP1 | TBK1 | Q9UHD2 | S | 109 | phosphorylation | Sparser_ProtMapperProtMapperRLIMS-P_ProtMapperREACH_ProtMapperPhosphoSitePhosphoSite_ProtMapper | ProtMapper:27753621 |
| PEBP1 | CDK5 | Q00535 | T | 42 | phosphorylation | PhosphoSiteSparser_ProtMapperProtMapper | ProtMapper:30181452ProtMapper:25104559 |
Ligand-Receptor Signaling (5)
5 records.
| Category | Parent | Database | Transmitter | Receiver | Secreted | Plasma Membrane (Transmembrane) | Plasma Membrane (Peripheral) |
|---|---|---|---|---|---|---|---|
| intracellular | intracellular | LOCATE | No | No | No | No | No |
| intracellular | intracellular | ComPPI | No | No | No | No | No |
| intracellular | intracellular | GO_Intercell | No | No | No | No | No |
| intracellular | intracellular | UniProt_location | No | No | No | No | No |
| intracellular | intracellular | OmniPath | No | No | No | No | No |
Regulatory Interaction Network (9)
9 records.
Protein Complex Composition (8)
8 records.
| Component Name | Component Gene Symbols | Component UniProt ID | Stoichiometry | Database | Database IDs | References |
|---|---|---|---|---|---|---|
| HT_DM_Cluster259 | DHRS2DHRS4DHRS4L2PEBP1 | P30086Q13268Q6PKH6Q9BTZ2 | 1:1:1:1 | Compleat | Compleat:HC1736 | 22036573 |
| HT_DM_Cluster436 | PEBP1PEBP4TBCB | P30086Q96S96Q99426 | 1:1:1 | Compleat | Compleat:HC1539 | 22036573 |
| HT_SC_Cluster342 | CPVLCTSAPEBP1 | P10619P30086Q9H3G5 | 1:1:1 | Compleat | Compleat:HC303 | |
| KIZPEBP1SCLT1TDRD6 | O60522P30086Q2M2Z5Q96NL6 | 0:0:0:0 | hu.MAP2 | |||
| DHPSEIF5AEIF5A2PEBP1RPL9P8UBC | P0CG48P30086P32969P49366P63241Q9GZV4 | 1:1:1:1:1:1 | NetworkBlastCompleat | Compleat:HC7039 | ||
| PEBP1 | P30086 | 2 | PDB | PDB:1bd9PDB:1beh | ||
| GLE1NUP107NUP133NUP153NUP214NUP58NUP85NUP98NXF1PEBP1SEC13SEH1LXPO5 | P30086P35658P49790P52948P55735P57740Q53GS7Q8WUM0Q96EE3Q9BVL2Q9BW27Q9HAV4Q9UBU9 | 1:1:1:1:1:1:1:1:1:1:1:1:1 | NetworkBlastCompleat | Compleat:HC6378 | ||
| NAA40PEBP1TSNTSNAX | P30086Q15631Q86UY6Q99598 | 1:1:1:1 | NetworkBlastCompleat | Compleat:HC8740 |
Isolation & Detection Technology (1)
1 record.
| EV Isolation Method | Detection Method | Number of References | References |
|---|---|---|---|
| Differential Ultracentrifugation | Mass spectrometryWestern blotting | 1 | 37886648 |
Sequence, Structure & Domains10
Sequences
Length
187
Mass
21,057
Sequence
MPVDLSKWSGPLSLQEVDEQPQHPLHVTYAGAAVDELGKVLTPTQVKNRPTSISWDGLDSGKLYTLVLTDPDAPSRKDPKYREWHHFLVVNMKGNDISSGTVLSDYVGSGPPKGTGLHRYVWLVYEQDRPLKCDEPILSNRSGDHRGKFKVASFRKKYELRAPVAGTCYQAEWDDYVPKLYEQLSGK
3D Structural Models
Turn
8..12; 43..46; 144..146; 184..186
Helix
5..7; 14..16; 97..99; 151..157; 177..183
Beta Strand
22..24; 26..28; 32..34; 51..54; 62..71; 76..78; 84..93; 100..104; 118..129; 140..142; 164..171
3D Structure
NMR spectroscopy (1); X-ray crystallography (3)
Domain & Motif Annotations
Region
93..134; Interaction with RAF1
Protein Families
Phosphatidylethanolamine-binding protein family
Sequence Similarities
Belongs to the phosphatidylethanolamine-binding protein family.
Clinical Relevance5
Supporting Publications36
| PMID | Title | Abstract |
|---|---|---|
| 33309826 | Proteomic analysis of extracellular vesicles and conditioned medium from human adipose-derived stem/stromal cells and dermal fibroblasts. | No abstract available |
| 33592500 | A Proteomic Approach to Understand the Clinical Significance of Acute Myeloid Leukemia-Derived Extracellular Vesicles Reflecting Essential Characteristics of Leukemia. | No abstract available |
| 34064677 | Ubiquinone Metabolism and Transcription HIF-1 Targets Pathway Are Toxicity Signature Pathways Present in Extracellular Vesicles of Paraquat-Exposed Human Brain Microvascular Endothelial Cells. | No abstract available |
| 34576246 | Burn Injury Induces Proinflammatory Plasma Extracellular Vesicles That Associate with Length of Hospital Stay in Women: CRP and SAA1 as Potential Prognostic Indicators. | No abstract available |
| 36064647 | Systemic proteomics and miRNA profile analysis of exosomes derived from human pluripotent stem cells. | No abstract available |
| 36146834 | Human Cytomegalovirus Modifies Placental Small Extracellular Vesicle Composition to Enhance Infection of Fetal Neural Cells In Vitro. | No abstract available |
| 36497184 | Oxidative Stress and Extracellular Matrix Remodeling Are Signature Pathways of Extracellular Vesicles Released upon Morphine Exposure on Human Brain Microvascular Endothelial Cells. | No abstract available |
| 36982312 | Saliva and Saliva Extracellular Vesicles for Biomarker Candidate Identification-Assay Development and Pilot Study in Amyotrophic Lateral Sclerosis. | No abstract available |
| 37204515 | Proteomic profiling and functional characterization of serum-derived extracellular vesicles in the mucinous and non-mucinous colon adenocarcinoma. | No abstract available |
| 37322475 | Comprehensive profiling of extracellular vesicles in uveitis and scleritis enables biomarker discovery and mechanism exploration. | No abstract available |