Protein detail
2AAB
Serine/threonine-protein phosphatase 2A 65 kDa regulatory subunit A beta isoform (PP2A subunit A isoform PR65-beta) (PP2A subunit A isoform R1-beta)
Entry name 2AAB | UniProt ID | EVMP score 0.38 |
Frequency 1 | Transmembrane count | Protein classification Human disease related genesPredicted intracellular proteins |
EVMP score: annotation confidence score.
Extremely high >= 0.85High >= 0.70Medium >= 0.55Low >= 0.40
Basic Information
Protein Names
Serine/threonine-protein phosphatase 2A 65 kDa regulatory subunit A beta isoform (PP2A subunit A isoform PR65-beta) (PP2A subunit A isoform R1-beta)
Protein Class
Human disease related genesPredicted intracellular proteins
Protein Function
- Human disease related genes:Cancers:Cancers of the lung and pleura
- Predicted intracellular proteins
Ensembl
Entrez Gene Symbol
Gene Synonym
PP2A-AbetaPR65B
Gene Description
Protein phosphatase 2 scaffold subunit Abeta
Chromosome
11
Position
111726908-111766389
Frequency
1
EVMP Score
0.38
Fluorescence & Localization
Tissue Specificadrenal glandCell SpecificAlveolar cells type 2Single-Nuclei Brain Specificendothelial cellBlood Cell SpecificneutrophilBlood Lineage SpecificgranulocytesSecretome LocationIntracellular and membraneSecretome FunctionEnzyme
Function & Pathway
Protein Function
- Human disease related genes:Cancers:Cancers of the lung and pleura
- Predicted intracellular proteins
Cellular Component
Biological Process
KEGG
- hsa03015 mRNA surveillance pathway
- KEGG:hsa04071 Sphingolipid signaling pathway
- KEGG:hsa04110 Cell cycle
- KEGG:hsa04114 Oocyte meiosis
- KEGG:hsa04151 PI3K-Akt signaling pathway
- KEGG:hsa04152 AMPK signaling pathway
- KEGG:hsa04261 Adrenergic signaling in cardiomyocytes
- KEGG:hsa04350 TGF-beta signaling pathway
- KEGG:hsa04382 Cornified envelope formation
- KEGG:hsa04390 Hippo signaling pathway
- KEGG:hsa04530 Tight junction
- KEGG:hsa04660 T cell receptor signaling pathway
- KEGG:hsa04728 Dopaminergic synapse
- KEGG:hsa04730 Long-term depression
- KEGG:hsa05142 Chagas disease
- KEGG:hsa05160 Hepatitis C
- KEGG:hsa05165 Human papillomavirus infection
Reactome
- R-hsa-1280218 adaptive immune system
- R-hsa-1169410 antimicrobial mechanism of ifn stimulated genes
- R-hsa-196299 beta catenin phosphorylation cascade
- R-hsa-9855142 cellular responses to mechanical stimuli
- R-hsa-8953897 cellular responses to stimuli
- R-hsa-1640170 cell cycle
- R-hsa-69620 cell cycle checkpoints
- R-hsa-69278 cell cycle mitotic
- R-hsa-389513 co inhibition by ctla4
- R-hsa-389356 co stimulation by cd28
- R-hsa-69273 cyclin a b1 b2 associated events during g2 m transition
- R-hsa-69231 cyclin d associated events in g1
- R-hsa-1280215 cytokine signaling in immune system
- R-hsa-180024 darpp 32 events
- R-hsa-195253 degradation of beta catenin by the destruction complex
- R-hsa-4641262 disassembly of the destruction complex and recruitment of axin to the membrane
- R-hsa-5663202 diseases of signal transduction by growth factor receptors and second messengers
- R-hsa-113510 e2f mediated regulation of dna replication
- R-hsa-202670 erks are inactivated
- R-hsa-198753 erk mapk targets
- R-hsa-70326 glucose metabolism
- R-hsa-418594 g alpha i signalling events
- R-hsa-109582 hemostasis
- R-hsa-113501 inhibition of replication initiation of damaged dna by rb1 e2f1
- R-hsa-168249 innate immune system
- R-hsa-163685 integration of energy metabolism
- R-hsa-913531 interferon signaling
- R-hsa-448424 interleukin 17 signaling
- R-hsa-9006925 intracellular signaling by second messengers
- R-hsa-5684996 mapk1 mapk3 signaling
- R-hsa-5683057 mapk family signaling cascades
- R-hsa-450282 mapk targets nuclear events mediated by map kinases
- R-hsa-2465910 mastl facilitates mitotic progression
- R-hsa-71387 metabolism of carbohydrates and carbohydrate derivatives
- R-hsa-453279 mitotic g1 phase and g1 s transition
- R-hsa-453274 mitotic g2 g2 m phases
- R-hsa-2555396 mitotic metaphase and anaphase
- R-hsa-68877 mitotic prometaphase
- R-hsa-68875 mitotic prophase
- R-hsa-69618 mitotic spindle checkpoint
- R-hsa-166166 myd88 independent tlr4 cascade
- R-hsa-68886 m phase
- R-hsa-5675221 negative regulation of mapk pathway
- R-hsa-199418 negative regulation of the pi3k akt network
- R-hsa-198725 nuclear events kinase and transcription factor activation
- R-hsa-111885 opioid signalling
- R-hsa-9833482 pkr mediated signaling
- R-hsa-418346 platelet homeostasis
- R-hsa-432142 platelet sensitization by ldl
- R-hsa-163767 pp2a mediated dephosphorylation of key metabolic factors
- R-hsa-5673000 raf activation
- R-hsa-9634600 regulation of glycolysis by fructose 2 6 bisphosphate metabolism
- R-hsa-5633007 regulation of tp53 activity
- R-hsa-6806003 regulation of tp53 expression and degradation
- R-hsa-388841 regulation of t cell activation by cd28 family
- R-hsa-2500257 resolution of sister chromatid cohesion
- R-hsa-5663220 rho gtpases activate formins
- R-hsa-195258 rho gtpase effectors
- R-hsa-73857 rna polymerase ii transcription
- R-hsa-2467813 separation of sister chromatids
- R-hsa-4839743 signaling by ctnnb1 phospho site mutants
- R-hsa-372790 signaling by gpcr
- R-hsa-449147 signaling by interleukins
- R-hsa-166520 signaling by ntrks
- R-hsa-9006934 signaling by receptor tyrosine kinases
- R-hsa-9716542 signaling by rho gtpases miro gtpases and rhobtb3
- R-hsa-195721 signaling by wnt
- R-hsa-4791275 signaling by wnt in cancer
- R-hsa-201681 tcf dependent signaling in response to wnt
- R-hsa-168138 toll like receptor 9 tlr9 cascade
- R-hsa-168898 toll like receptor cascades
- R-hsa-168179 toll like receptor tlr1 tlr2 cascade
- R-hsa-3700989 transcriptional regulation by tp53
- R-hsa-9860927 turbulent oscillatory disturbed flow shear stress activates signaling by piezo1 and integrins in endothelial cells
Mediation Categories
Clinical-translation mediationFusion and delivery mediationImmune mediationMetabolism mediationReceptor-signaling mediation
Relations & Evidence
Enzyme-Mediated Modification
Ligand-Receptor Signaling
4 records.
| Category | Parent | Database | Transmitter | Receiver | Secreted | Plasma Membrane (Transmembrane) | Plasma Membrane (Peripheral) |
|---|---|---|---|---|---|---|---|
| intracellular | intracellular | LOCATE | No | No | No | No | No |
| intracellular | intracellular | ComPPI | No | No | No | No | No |
| intracellular | intracellular | GO_Intercell | No | No | No | No | No |
| intracellular | intracellular | OmniPath | No | No | No | No | No |
Regulatory Interaction Network
1 record.
| Source Protein Symbol | Source UniProt ID | Target Protein Symbol | Target UniProt ID | Is Directed | Is Stimulation | Is Inhibition | Database | References |
|---|---|---|---|---|---|---|---|---|
| 2AAB | P30154 | PP2AA | P67775 | Yes | Yes | No | SIGNORHPRDHINTIntActWang | HINT:17540176HINT:11313937HPRD:17540176SIGNOR:19114990HINT:35271311HINT:12370081HINT:28330616IntAct:18715871HINT:19156129HPRD:18715871IntAct:17540176HINT:18782753HINT:18715871 |
Protein Complex Composition
19 records.
Page 1 of 2Next
Sequence, Structure & Domains
Sequences
Length
601
Mass
66,214
Sequence
MAGASELGTGPGAAGGDGDDSLYPIAVLIDELRNEDVQLRLNSIKKLSTIALALGVERTRSELLPFLTDTIYDEDEVLLALAEQLGNFTGLVGGPDFAHCLLPPLENLATVEETVVRDKAVESLRQISQEHTPVALEAYFVPLVKRLASGDWFTSRTSACGLFSVCYPRASNAVKAEIRQQFRSLCSDDTPMVRRAAASKLGEFAKVLELDSVKSEIVPLFTSLASDEQDSVRLLAVEACVSIAQLLSQDDLETLVMPTLRQAAEDKSWRVRYMVADRFSELQKAMGPKITLNDLIPAFQNLLKDCEAEVRAAAAHKVKELGENLPIEDRETIIMNQILPYIKELVSDTNQHVKSALASVIMGLSTILGKENTIEHLLPLFLAQLKDECPDVRLNIISNLDCVNEVIGIRQLSQSLLPAIVELAEDAKWRVRLAIIEYMPLLAGQLGVEFFDEKLNSLCMAWLVDHVYAIREAATNNLMKLVQKFGTEWAQNTIVPKVLVMANDPNYLHRMTTLFCINALSEACGQEITTKQMLPIVLKMAGDQVANVRFNVAKSLQKIGPILDTNALQGEVKPVLQKLGQDEDMDVKYFAQEAISVLALA
Alternative Products
Event=Alternative splicing; Named isoforms=5; Name=1; IsoId=P30154-1; Sequence=Displayed; Name=2; IsoId=P30154-2; Sequence=VSP_036460; Name=3; IsoId=P30154-3; Sequence=VSP_043379, VSP_036460; Name=4; IsoId=P30154-4; Sequence=VSP_045275; Name=5; IsoId=P30154-5; Sequence=VSP_046684
Alternative Sequence
39..102; Missing (in isoform 3); 103..229; Missing (in isoform 5); 344..388; Missing (in isoform 4); 598..601; LALA -> VAQRLRKLEFPVKDSGEPSVPRADKNHFPRPTVPGEDMGKGPVYQLRGDTRDTLAQLGIAELVHFSQSTD (in isoform 2 and isoform 3)
3D Structural Models
3D Structure
Electron microscopy (1)
Domain & Motif Annotations
Repeat
20..58; HEAT 1; 59..96; HEAT 2; 97..135; HEAT 3; 136..173; HEAT 4; 174..212; HEAT 5; 213..251; HEAT 6; 252..290; HEAT 7; 291..333; HEAT 8; 334..372; HEAT 9; 373..411; HEAT 10; 412..450; HEAT 11; 451..489; HEAT 12; 490..528; HEAT 13; 529..567; HEAT 14; 568..601; HEAT 15
Domain (CC)
Each HEAT repeat appears to consist of two alpha helices joined by a hydrophilic region, the intrarepeat loop. The repeat units may be arranged laterally to form a rod-like structure.
Protein Families
Phosphatase 2A regulatory subunit A family
Sequence Similarities
Belongs to the phosphatase 2A regulatory subunit A family.
Clinical Relevance
Interaction Protein
ENSG00000006451ENSG00000066027ENSG00000078304ENSG00000104695ENSG00000105568ENSG00000112640ENSG00000113575ENSG00000154001ENSG00000175470ENSG00000221914
Interaction Count
10
Interaction Dataset
intact_biogridintact_biogrid_bioplexbiogrid_opencell_bioplexintact_biogrid_opencellbiogrid_bioplex