Protein detail
2AAB
Serine/threonine-protein phosphatase 2A 65 kDa regulatory subunit A beta isoform (PP2A subunit A isoform PR65-beta) (PP2A subunit A isoform R1-beta)
Entry name 2AAB | UniProt ID | EVMP confidence score 0.40 |
Supporting publications (n) 1 | Transmembrane count | Protein classification Human disease related genesPredicted intracellular proteins |
Annotation confidence score; open for threshold definitions.
Extremely high >= 0.70High >= 0.60Medium >= 0.40Low >= 0.30Basic Information
Protein Names
Serine/threonine-protein phosphatase 2A 65 kDa regulatory subunit A beta isoform (PP2A subunit A isoform PR65-beta) (PP2A subunit A isoform R1-beta)
Protein Class (2)
Human disease related genesPredicted intracellular proteins
Protein Function (2)
- Human disease related genes:Cancers:Cancers of the lung and pleura
- Predicted intracellular proteins
Ensembl
Entrez Gene Symbol
Gene Synonym (2)
PP2A-AbetaPR65B
Gene Description
Protein phosphatase 2 scaffold subunit Abeta
Chromosome
11
Position
111726908-111766389
Supporting publications (n)
1
EVMP confidence score
0.40
Fluorescence & Localization
Tissue Specificadrenal glandCell SpecificAlveolar cells type 2Single-Nuclei Brain Specificendothelial cellBlood Cell SpecificneutrophilBlood Lineage SpecificgranulocytesSecretome LocationIntracellular and membraneSecretome FunctionEnzyme
Function & Pathway
Protein Function (2)
- Human disease related genes:Cancers:Cancers of the lung and pleura
- Predicted intracellular proteins
Cellular Component (6)
Molecular Function (2)
Biological Process (3)
KEGG (17)
- hsa03015 mRNA surveillance pathway
- KEGG:hsa04071 Sphingolipid signaling pathway
- KEGG:hsa04110 Cell cycle
- KEGG:hsa04114 Oocyte meiosis
- KEGG:hsa04151 PI3K-Akt signaling pathway
- KEGG:hsa04152 AMPK signaling pathway
- KEGG:hsa04261 Adrenergic signaling in cardiomyocytes
- KEGG:hsa04350 TGF-beta signaling pathway
- KEGG:hsa04382 Cornified envelope formation
- KEGG:hsa04390 Hippo signaling pathway
Page 1 of 2
Reactome (74)
- R-hsa-1280218 adaptive immune system
- R-hsa-1169410 antimicrobial mechanism of ifn stimulated genes
- R-hsa-196299 beta catenin phosphorylation cascade
- R-hsa-9855142 cellular responses to mechanical stimuli
- R-hsa-8953897 cellular responses to stimuli
- R-hsa-1640170 cell cycle
- R-hsa-69620 cell cycle checkpoints
- R-hsa-69278 cell cycle mitotic
- R-hsa-389513 co inhibition by ctla4
- R-hsa-389356 co stimulation by cd28
Page 1 of 8
Mediation Categories (5)
Clinical-translation mediationFusion and delivery mediationImmune mediationMetabolism mediationReceptor-signaling mediation
Relations & Evidence27
Enzyme-Mediated Modification (2)
Ligand-Receptor Signaling (4)
4 records.
| Category | Parent | Database | Transmitter | Receiver | Secreted | Plasma Membrane (Transmembrane) | Plasma Membrane (Peripheral) |
|---|---|---|---|---|---|---|---|
| intracellular | intracellular | LOCATE | |||||
| intracellular | intracellular | ComPPI | |||||
| intracellular | intracellular | GO_Intercell | |||||
| intracellular | intracellular | OmniPath |
Regulatory Interaction Network (1)
1 record.
| Source Protein Symbol | Source UniProt ID | Target Protein Symbol | Target UniProt ID | Is Directed | Is Stimulation | Is Inhibition | Database | References |
|---|---|---|---|---|---|---|---|---|
| 2AAB | P30154 | PP2AA | P67775 | Yes | Yes | SIGNORHPRDHINTIntActWang | HINT:17540176HINT:11313937HPRD:17540176SIGNOR:19114990HINT:35271311HINT:12370081HINT:28330616IntAct:18715871HINT:19156129HPRD:18715871IntAct:17540176HINT:18782753HINT:18715871 |
Protein Complex Composition (19)
19 records.
| Component Name | Component Gene Symbols | Component UniProt ID | Stoichiometry | Database | Database IDs | References |
|---|---|---|---|---|---|---|
| PPP2CAPPP2CBPPP2R1APPP2R1BPPP2R5APPP2R5BPPP2R5CPPP2R5DPPP2R5ESGO1 | P30153P30154P62714P67775Q13362Q14738Q15172Q15173Q16537Q5FBB7 | 0:0:0:0:0:0:0:0:0:0 | KEGG-MEDICUS | |||
| PPP2CAPPP2R1APPP2R1BPPP2R2APPP2R5D | P30153P30154P63151P67775Q14738 | 0:0:0:0:0 | Havugimana2012 | Havugimana2012:C_467 | ||
| PPP2R1APPP2R1BPPP2R5E | P30153P30154Q16537 | 0:0:0 | hu.MAP2 | |||
| CCT8PPP2CAPPP2R1BPPP2R2BPPP2R2C | P30154P50990P67775Q00005Q9Y2T4 | 1:1:1:1:1 | CompleatCFinder | Compleat:HC8829 | ||
| ARFIP2PPFIA1PPP2CAPPP2R1BPPP2R5CPPP2R5DPPP2R5E | P30154P53365P67775Q13136Q13362Q14738Q16537 | 0:0:0:0:0:0:0 | hu.MAP | |||
| PPP2CBPPP2R1B | P30154P62714 | 0:0 | hu.MAP2 | |||
| PPP2CAPPP2R1BPPP2R5C | P30154P67775Q13362 | 1:1:1 | PDB | PDB:9mf5 | ||
| PPP2R1BPPP2R5APPP2R5CPPP2R5DPPP2R5E | P30154Q13362Q14738Q15172Q16537 | 0:0:0:0:0 | hu.MAP | |||
| PPP2R1BPPP2R5APPP2R5DPPP2R5E | P30154Q14738Q15172Q16537 | 0:0:0:0 | hu.MAP |
Page 2 of 2Previous
Sequence, Structure & Domains
Sequences
Length
601
Mass
66,214
Sequence
MAGASELGTGPGAAGGDGDDSLYPIAVLIDELRNEDVQLRLNSIKKLSTIALALGVERTRSELLPFLTDTIYDEDEVLLALAEQLGNFTGLVGGPDFAHCLLPPLENLATVEETVVRDKAVESLRQISQEHTPVALEAYFVPLVKRLASGDWFTSRTSACGLFSVCYPRASNAVKAEIRQQFRSLCSDDTPMVRRAAASKLGEFAKVLELDSVKSEIVPLFTSLASDEQDSVRLLAVEACVSIAQLLSQDDLETLVMPTLRQAAEDKSWRVRYMVADRFSELQKAMGPKITLNDLIPAFQNLLKDCEAEVRAAAAHKVKELGENLPIEDRETIIMNQILPYIKELVSDTNQHVKSALASVIMGLSTILGKENTIEHLLPLFLAQLKDECPDVRLNIISNLDCVNEVIGIRQLSQSLLPAIVELAEDAKWRVRLAIIEYMPLLAGQLGVEFFDEKLNSLCMAWLVDHVYAIREAATNNLMKLVQKFGTEWAQNTIVPKVLVMANDPNYLHRMTTLFCINALSEACGQEITTKQMLPIVLKMAGDQVANVRFNVAKSLQKIGPILDTNALQGEVKPVLQKLGQDEDMDVKYFAQEAISVLALA
Alternative Products
Event=Alternative splicing; Named isoforms=5; Name=1; IsoId=P30154-1; Sequence=Displayed; Name=2; IsoId=P30154-2; Sequence=VSP_036460; Name=3; IsoId=P30154-3; Sequence=VSP_043379, VSP_036460; Name=4; IsoId=P30154-4; Sequence=VSP_045275; Name=5; IsoId=P30154-5; Sequence=VSP_046684
Alternative Sequence
39..102; Missing (in isoform 3); 103..229; Missing (in isoform 5); 344..388; Missing (in isoform 4); 598..601; LALA -> VAQRLRKLEFPVKDSGEPSVPRADKNHFPRPTVPGEDMGKGPVYQLRGDTRDTLAQLGIAELVHFSQSTD (in isoform 2 and isoform 3)
3D Structural Models
3D Structure
Electron microscopy (1)
Domain & Motif Annotations
Repeat
20..58; HEAT 1; 59..96; HEAT 2; 97..135; HEAT 3; 136..173; HEAT 4; 174..212; HEAT 5; 213..251; HEAT 6; 252..290; HEAT 7; 291..333; HEAT 8; 334..372; HEAT 9; 373..411; HEAT 10; 412..450; HEAT 11; 451..489; HEAT 12; 490..528; HEAT 13; 529..567; HEAT 14; 568..601; HEAT 15
Domain (CC)
Each HEAT repeat appears to consist of two alpha helices joined by a hydrophilic region, the intrarepeat loop. The repeat units may be arranged laterally to form a rod-like structure.
Protein Families
Phosphatase 2A regulatory subunit A family
Sequence Similarities
Belongs to the phosphatase 2A regulatory subunit A family.
Clinical Relevance
Interaction Protein (10)
ENSG00000006451ENSG00000066027ENSG00000078304ENSG00000104695ENSG00000105568ENSG00000112640ENSG00000113575ENSG00000154001ENSG00000175470ENSG00000221914
Interaction Count
10
Interaction Dataset (5)
intact_biogridintact_biogrid_bioplexbiogrid_opencell_bioplexintact_biogrid_opencellbiogrid_bioplex
Supporting Publications1
| PMID | Title | Related sentences |
|---|---|---|
| 32384937 | Alzheimer's disease progression characterized by alterations in the molecular profiles and biogenesis of brain extracellular vesicles. | No related sentences available |