Protein detail

2AAB

Serine/threonine-protein phosphatase 2A 65 kDa regulatory subunit A beta isoform (PP2A subunit A isoform PR65-beta) (PP2A subunit A isoform R1-beta)

Entry name 2AAB	UniProt ID P30154	EVMP confidence score 0.38
Supporting publications (n) 1	Transmembrane count	Protein classification Human disease related genesPredicted intracellular proteins

EVMP confidence score

Annotation confidence score; open for threshold definitions.

Extremely high >= 0.85High >= 0.70Medium >= 0.55Low >= 0.40

Basic Information11

Protein Names

Serine/threonine-protein phosphatase 2A 65 kDa regulatory subunit A beta isoform (PP2A subunit A isoform PR65-beta) (PP2A subunit A isoform R1-beta)

Protein Class (2)

Human disease related genesPredicted intracellular proteins

Protein Function (2)

Human disease related genes:Cancers:Cancers of the lung and pleura
Predicted intracellular proteins

Ensembl

ENSG00000137713

Entrez Gene Symbol

PPP2R1B

Gene Synonym (2)

PP2A-AbetaPR65B

Gene Description

Protein phosphatase 2 scaffold subunit Abeta

Chromosome

Position

111726908-111766389

Supporting publications (n)

EVMP confidence score

0.38

Fluorescence & Localization7

Tissue Specificadrenal glandCell SpecificAlveolar cells type 2Single-Nuclei Brain Specificendothelial cellBlood Cell SpecificneutrophilBlood Lineage SpecificgranulocytesSecretome LocationIntracellular and membraneSecretome FunctionEnzyme

Function & Pathway7

Protein Function (2)

Human disease related genes:Cancers:Cancers of the lung and pleura
Predicted intracellular proteins

Cellular Component (6)

Molecular Function (2)

Biological Process (3)

KEGG (17)

Page 1 of 2

Reactome (74)

Page 1 of 8

Mediation Categories (5)

Clinical-translation mediationFusion and delivery mediationImmune mediationMetabolism mediationReceptor-signaling mediation

Relations & Evidence27

Enzyme-Mediated Modification (2)

2 records.

Substrate Gene Symbol	Enzyme Gene Symbol	Enzyme UniProt ID	Residue Type	Residue Offset	Modification	Database	References
PPP2R1B	MYLK2	Q9H1R3	S	212	phosphorylation	PhosphoNetworks
PPP2R1B	TRIB3	Q96RU7	S	212	phosphorylation	PhosphoNetworks

Ligand-Receptor Signaling (4)

4 records.

Category	Parent	Database	Transmitter	Receiver	Secreted	Plasma Membrane (Transmembrane)	Plasma Membrane (Peripheral)
intracellular	intracellular	LOCATE	No	No	No	No	No
intracellular	intracellular	ComPPI	No	No	No	No	No
intracellular	intracellular	GO_Intercell	No	No	No	No	No
intracellular	intracellular	OmniPath	No	No	No	No	No

Regulatory Interaction Network (1)

1 record.

Source Protein Symbol	Source UniProt ID	Target Protein Symbol	Target UniProt ID	Is Directed	Is Stimulation	Is Inhibition	Database	References
2AAB	P30154	PP2AA	P67775	Yes	Yes	No	SIGNORHPRDHINTIntActWang	HINT:17540176 HINT:11313937 HPRD:17540176 SIGNOR:19114990 HINT:35271311 HINT:12370081 HINT:28330616 IntAct:18715871 HINT:19156129 HPRD:18715871 IntAct:17540176 HINT:18782753 HINT:18715871

Protein Complex Composition (19)

19 records.

Component Gene Symbols	Component UniProt ID	Stoichiometry	Database	Database IDs
PPP2CA PPP2CB PPP2R1A PPP2R1B PPP2R5A PPP2R5B PPP2R5C PPP2R5D PPP2R5E SGO1	P30153 P30154 P62714 P67775 Q13362 Q14738 Q15172 Q15173 Q16537 Q5FBB7	0:0:0:0:0:0:0:0:0:0	KEGG-MEDICUS
PPP2CA PPP2R1A PPP2R1B PPP2R2A PPP2R5D	P30153 P30154 P63151 P67775 Q14738	0:0:0:0:0	Havugimana2012	Havugimana2012:C_467
PPP2R1A PPP2R1B PPP2R5E	P30153 P30154 Q16537	0:0:0	hu.MAP2
CCT8 PPP2CA PPP2R1B PPP2R2B PPP2R2C	P30154 P50990 P67775 Q00005 Q9Y2T4	1:1:1:1:1	CompleatCFinder	Compleat:HC8829
ARFIP2 PPFIA1 PPP2CA PPP2R1B PPP2R5C PPP2R5D PPP2R5E	P30154 P53365 P67775 Q13136 Q13362 Q14738 Q16537	0:0:0:0:0:0:0	hu.MAP
PPP2CB PPP2R1B	P30154 P62714	0:0	hu.MAP2
PPP2CA PPP2R1B PPP2R5C	P30154 P67775 Q13362	1:1:1	PDB	PDB:9mf5
PPP2R1B PPP2R5A PPP2R5C PPP2R5D PPP2R5E	P30154 Q13362 Q14738 Q15172 Q16537	0:0:0:0:0	hu.MAP
PPP2R1B PPP2R5A PPP2R5D PPP2R5E	P30154 Q14738 Q15172 Q16537	0:0:0:0	hu.MAP

Page 2 of 2Previous

Isolation & Detection Technology (1)

1 record.

EV Isolation Method	Detection Method	Number of References	References
Differential UltracentrifugationUltrafiltration / Tangential Flow Filtration	Mass spectrometry	2	27487081 38607062

Sequence, Structure & Domains10

Sequences

Length

601

Mass

66,214

Sequence

MAGASELGTGPGAAGGDGDDSLYPIAVLIDELRNEDVQLRLNSIKKLSTIALALGVERTRSELLPFLTDTIYDEDEVLLALAEQLGNFTGLVGGPDFAHCLLPPLENLATVEETVVRDKAVESLRQISQEHTPVALEAYFVPLVKRLASGDWFTSRTSACGLFSVCYPRASNAVKAEIRQQFRSLCSDDTPMVRRAAASKLGEFAKVLELDSVKSEIVPLFTSLASDEQDSVRLLAVEACVSIAQLLSQDDLETLVMPTLRQAAEDKSWRVRYMVADRFSELQKAMGPKITLNDLIPAFQNLLKDCEAEVRAAAAHKVKELGENLPIEDRETIIMNQILPYIKELVSDTNQHVKSALASVIMGLSTILGKENTIEHLLPLFLAQLKDECPDVRLNIISNLDCVNEVIGIRQLSQSLLPAIVELAEDAKWRVRLAIIEYMPLLAGQLGVEFFDEKLNSLCMAWLVDHVYAIREAATNNLMKLVQKFGTEWAQNTIVPKVLVMANDPNYLHRMTTLFCINALSEACGQEITTKQMLPIVLKMAGDQVANVRFNVAKSLQKIGPILDTNALQGEVKPVLQKLGQDEDMDVKYFAQEAISVLALA

Alternative Products

Event=Alternative splicing; Named isoforms=5; Name=1; IsoId=P30154-1; Sequence=Displayed; Name=2; IsoId=P30154-2; Sequence=VSP_036460; Name=3; IsoId=P30154-3; Sequence=VSP_043379, VSP_036460; Name=4; IsoId=P30154-4; Sequence=VSP_045275; Name=5; IsoId=P30154-5; Sequence=VSP_046684

Alternative Sequence

39..102; Missing (in isoform 3); 103..229; Missing (in isoform 5); 344..388; Missing (in isoform 4); 598..601; LALA -> VAQRLRKLEFPVKDSGEPSVPRADKNHFPRPTVPGEDMGKGPVYQLRGDTRDTLAQLGIAELVHFSQSTD (in isoform 2 and isoform 3)

3D Structural Models

3D Structure

Electron microscopy (1)

Domain & Motif Annotations

Repeat

20..58; HEAT 1; 59..96; HEAT 2; 97..135; HEAT 3; 136..173; HEAT 4; 174..212; HEAT 5; 213..251; HEAT 6; 252..290; HEAT 7; 291..333; HEAT 8; 334..372; HEAT 9; 373..411; HEAT 10; 412..450; HEAT 11; 451..489; HEAT 12; 490..528; HEAT 13; 529..567; HEAT 14; 568..601; HEAT 15

Domain (CC)

Each HEAT repeat appears to consist of two alpha helices joined by a hydrophilic region, the intrarepeat loop. The repeat units may be arranged laterally to form a rod-like structure.

Protein Families

Phosphatase 2A regulatory subunit A family

Sequence Similarities

Belongs to the phosphatase 2A regulatory subunit A family.

Clinical Relevance4

Antibody (2)

CAB004034 HPA018908

Interaction Protein (10)

ENSG00000006451ENSG00000066027ENSG00000078304ENSG00000104695ENSG00000105568ENSG00000112640ENSG00000113575ENSG00000154001ENSG00000175470ENSG00000221914

Interaction Count

Interaction Dataset (5)

intact_biogridintact_biogrid_bioplexbiogrid_opencell_bioplexintact_biogrid_opencellbiogrid_bioplex

Supporting Publications1

PMID	Title	Abstract
32384937	Alzheimer's disease progression characterized by alterations in the molecular profiles and biogenesis of brain extracellular vesicles.	No abstract available