Protein detail
IL2RG
Cytokine receptor common subunit gamma (Interleukin-2 receptor subunit gamma) (IL-2 receptor subunit gamma) (IL-2R subunit gamma) (IL-2RG) (gammaC) (p64) (CD antigen CD132)
Entry name IL2RG | UniProt ID | EVMP confidence score 0.63 |
Supporting publications (n) 8 | Transmembrane count 1 | Protein classification Cancer-related genesCD markersDisease related genesFDA approved drug targetsHuman disease related genesPredicted intracellular proteinsPredicted membrane proteins |
Annotation confidence score; open for threshold definitions.
Extremely high >= 0.70High >= 0.60Medium >= 0.40Low >= 0.30Basic Information
Protein Names
Cytokine receptor common subunit gamma (Interleukin-2 receptor subunit gamma) (IL-2 receptor subunit gamma) (IL-2R subunit gamma) (IL-2RG) (gammaC) (p64) (CD antigen CD132)
Protein Class (7)
Cancer-related genesCD markersDisease related genesFDA approved drug targetsHuman disease related genesPredicted intracellular proteinsPredicted membrane proteins
Protein Function (6)
- Predicted intracellular proteins
- CD markers
- Human disease related genes:Immune system diseases:Primary immunodeficiency
- Cancer-related genes:Candidate cancer biomarkers
- Disease related genes
- FDA approved drug targets:Biotech drugs
Transmembrane
263..283; Helical
Transmembrane Count
1
Ensembl
Entrez Gene Symbol
Gene Synonym (4)
CD132CIDXIMD4SCIDX1
Gene Description
Interleukin 2 receptor subunit gamma
Chromosome
X
Position
71107404-71112108
Supporting publications (n)
8
EVMP confidence score
0.63
Fluorescence & Localization
Tissue Specifictestis
Function & Pathway
Protein Function (6)
- Predicted intracellular proteins
- CD markers
- Human disease related genes:Immune system diseases:Primary immunodeficiency
- Cancer-related genes:Candidate cancer biomarkers
- Disease related genes
- FDA approved drug targets:Biotech drugs
Cellular Component (9)
Molecular Function (9)
- GO:0004896 cytokine receptor activity
- GO:0004911 interleukin-2 receptor activity
- GO:0004913 interleukin-4 receptor activity
- GO:0004917 interleukin-7 receptor activity
- GO:0005515 protein binding
- GO:0015026 coreceptor activity
- GO:0019955 cytokine binding
- GO:0019976 interleukin-2 binding
- GO:0042010 interleukin-15 receptor activity
Biological Process (3)
KEGG (12)
- hsa04060 Cytokine-cytokine receptor interaction
- KEGG:hsa04061 Viral protein interaction with cytokine and cytokine receptor
- KEGG:hsa04144 Endocytosis
- KEGG:hsa04151 PI3K-Akt signaling pathway
- KEGG:hsa04630 JAK-STAT signaling pathway
- KEGG:hsa04658 Th1 and Th2 cell differentiation
- KEGG:hsa04659 Th17 cell differentiation
- KEGG:hsa05162 Measles
- KEGG:hsa05166 Human T-cell leukemia virus 1 infection
- KEGG:hsa05200 Pathways in cancer
Page 1 of 2
Reactome (16)
- R-hsa-1280215 cytokine signaling in immune system
- R-hsa-8983432 interleukin 15 signaling
- R-hsa-9020958 interleukin 21 signaling
- R-hsa-451927 interleukin 2 family signaling
- R-hsa-9020558 interleukin 2 signaling
- R-hsa-512988 interleukin 3 interleukin 5 and gm csf signaling
- R-hsa-6785807 interleukin 4 and interleukin 13 signaling
- R-hsa-1266695 interleukin 7 signaling
- R-hsa-8985947 interleukin 9 signaling
- R-hsa-912526 interleukin receptor shc signaling
Page 1 of 2
Canonical Pathways (3)
- M274 Pid lymph angiogenesis pathway
- M47 Pid integrin cs pathway
- M240 Pid syndecan 2 pathway
Mediation Categories (5)
Adhesion and uptake mediationClinical-translation mediationFusion and delivery mediationImmune mediationReceptor-signaling mediation
Relations & Evidence82
Ligand-Receptor Signaling (68)
68 records.
| Category | Parent | Database | Transmitter | Receiver | Secreted | Plasma Membrane (Transmembrane) | Plasma Membrane (Peripheral) |
|---|---|---|---|---|---|---|---|
| transmembrane | transmembrane | TopDB | Yes | ||||
| transmembrane | transmembrane | Ramilowski_location | Yes | ||||
| transmembrane | transmembrane | OmniPath | Yes | ||||
| plasma_membrane | plasma_membrane | UniProt_location | Yes | ||||
| plasma_membrane | plasma_membrane | Cellinker | Yes | ||||
| plasma_membrane | plasma_membrane | OmniPath | Yes | ||||
| plasma_membrane_transmembrane | plasma_membrane_transmembrane | Membranome | Yes | ||||
| plasma_membrane_transmembrane | plasma_membrane_transmembrane | CSPA | Yes | ||||
| plasma_membrane_transmembrane | plasma_membrane_transmembrane | HPMR | Yes | ||||
| plasma_membrane_transmembrane | plasma_membrane_transmembrane | OmniPath | Yes |
Regulatory Interaction Network (9)
9 records.
Protein Complex Composition (4)
4 records.
| Component Name | Component Gene Symbols | Component UniProt ID | Stoichiometry | Database | Database IDs | References |
|---|---|---|---|---|---|---|
| IL9_receptor | IL2RGIL9R | P31785Q01113 | 1:1 | Guide2PharmaCellChatDBCellPhoneDBICELLNETCellinker | CellPhoneDB:IL9_receptor | 15546386 |
| IL2RGIL4 | P05112P31785 | 2:2 | PDB | PDB:3qb7 | ||
| IL2RGPLP1REEP6 | P31785P60201Q96HR9 | 0:0:0 | hu.MAP2 | |||
| IL2RGREEP6 | P31785Q96HR9 | 0:0 | hu.MAPhu.MAP2 |
Sequence, Structure & Domains
Sequences
Length
369
Mass
42,287
Sequence
MLKPSLPFTSLLFLQLPLLGVGLNTTILTPNGNEDTTADFFLTTMPTDSLSVSTLPLPEVQCFVFNVEYMNCTWNSSSEPQPTNLTLHYWYKNSDNDKVQKCSHYLFSEEITSGCQLQKKEIHLYQTFVVQLQDPREPRRQATQMLKLQNLVIPWAPENLTLHKLSESQLELNWNNRFLNHCLEHLVQYRTDWDHSWTEQSVDYRHKFSLPSVDGQKRYTFRVRSRFNPLCGSAQHWSEWSHPIHWGSNTSKENPFLFALEAVVISVGSMGLIISLLCVYFWLERTMPRIPTLKNLEDLVTEYHGNFSAWSGVSKGLAESLQPDYSERLCLVSEIPPKGGALGEGPGASPCNQHSPYWAPPCYTLKPET
Alternative Products
Event=Alternative splicing; Named isoforms=2; Name=1; IsoId=P31785-1; Sequence=Displayed; Name=2; IsoId=P31785-2; Sequence=VSP_047581, VSP_047582
Alternative Sequence
1..8; MLKPSLPF -> MGMKTPQL (in isoform 2); 9..198; Missing (in isoform 2)
3D Structural Models
Turn
66..68
Helix
119..121; 148..150; 180..182
Beta Strand
61..65; 69..73; 78..81; 86..91; 94..96; 99..101; 103..108; 111..118; 124..126; 128..133; 135..137; 141..146; 151..153; 158..166; 169..175; 184..191; 198..202; 207..210; 215..217; 219..226; 229..231; 244..246
3D Structure
Electron microscopy (2); X-ray crystallography (10)
Domain & Motif Annotations
Motif
237..241; WSXWS motif; 286..294; Box 1 motif
Domain (CC)
The WSXWS motif appears to be necessary for proper protein folding and thereby efficient intracellular transport and cell-surface receptor binding.; DOMAIN: The box 1 motif is required for JAK interaction and/or activation.
Domain (FT)
156..253; Fibronectin type-III
Protein Families (2)
- Type I cytokine receptor family
- Type 5 subfamily
Sequence Similarities
Belongs to the type I cytokine receptor family. Type 5 subfamily.
Clinical Relevance
Disease Involvement (4)
Cancer-related genesDisease variantFDA approved drug targetsSCID
Related Diseases
Drug Targets
FDA approved drug targets
Drugs (10)
Supporting Publications8
| PMID | Title | Related sentences |
|---|---|---|
| 27894104 | Proteomic profiling of NCI-60 extracellular vesicles uncovers common protein cargo and cancer type-specific biomarkers. | No related sentences available |
| 29045505 | Surfaceome profiling enables isolation of cancer-specific exosomal cargo in liquid biopsies from pancreatic cancer patients. | Proteomic analysis of the exosome 'surfaceome' revealed multiple PDAC-specific biomarker candidates: CLDN4, EPCAM, CD151, LGALS3BP, HIST2H2BE, and HIST2H2BF. Droplet digital PCR was used on 74 patients (136 total exosome samples) to determine baseline KRAS mutation call rates while patients were on therapy. KRAS mutations in total exosomes were detected in 44.1% of patients undergoing active therapy compared with 73.0% following exosome capture using the selected biomarkers. |
| 29148239 | Metabolic Signature of Microvesicles from Umbilical Cord Mesenchymal Stem Cells of Preterm and Term Infants. | No related sentences available |
| 32089743 | Human umbilical cord mesenchymal stromal cells-derived extracellular vesicles exert potent bone protective effects by CLEC11A-mediated regulation of bone metabolism. | No related sentences available |
| 34817906 | Proteomic dissection of large extracellular vesicle surfaceome unravels interactive surface platform. | No related sentences available |
| 36398564 | Differential ultracentrifugation enables deep plasma proteomics through enrichment of extracellular vesicles. | No related sentences available |
| 39569406 | Proteomics of circulating extracellular vesicles reveals diverse clinical presentations of COVID-19 but fails to identify viral peptides. | No related sentences available |
| 39766158 | A Proteomic Examination of Plasma Extracellular Vesicles Across Colorectal Cancer Stages Uncovers Biological Insights That Potentially Improve Prognosis. | No related sentences available |