Protein detail
IL2RG
Cytokine receptor common subunit gamma (Interleukin-2 receptor subunit gamma) (IL-2 receptor subunit gamma) (IL-2R subunit gamma) (IL-2RG) (gammaC) (p64) (CD antigen CD132)
Protein symbol IL2RG | UniProt ID | EVMP score 0.63 |
Frequency 9 | Transmembrane count 1 | Protein classification Cancer-related genesCD markersDisease related genesFDA approved drug targetsHuman disease related genesPredicted intracellular proteinsPredicted membrane proteins |
EVMP score: annotation confidence score.
Extremely high >= 0.85High >= 0.70Medium >= 0.55Low >= 0.40
Basic Information
Protein Names
Cytokine receptor common subunit gamma (Interleukin-2 receptor subunit gamma) (IL-2 receptor subunit gamma) (IL-2R subunit gamma) (IL-2RG) (gammaC) (p64) (CD antigen CD132)
Protein Class
Cancer-related genesCD markersDisease related genesFDA approved drug targetsHuman disease related genesPredicted intracellular proteinsPredicted membrane proteins
Protein Function
- Predicted intracellular proteins
- CD markers
- Human disease related genes:Immune system diseases:Primary immunodeficiency
- Cancer-related genes:Candidate cancer biomarkers
- Disease related genes
- FDA approved drug targets:Biotech drugs
Transmembrane
263..283; Helical
Transmembrane Count
1
Ensembl
Entrez Gene Symbol
Gene Synonym
CD132CIDXIMD4SCIDX1
Gene Description
Interleukin 2 receptor subunit gamma
Chromosome
X
Position
71107404-71112108
Frequency
9
EVMP Score
0.63
Fluorescence & Localization
Tissue Specifictestis
Function & Pathway
Protein Function
- Predicted intracellular proteins
- CD markers
- Human disease related genes:Immune system diseases:Primary immunodeficiency
- Cancer-related genes:Candidate cancer biomarkers
- Disease related genes
- FDA approved drug targets:Biotech drugs
Cellular Component
Molecular Function
- GO:0004896 cytokine receptor activity
- GO:0004911 interleukin-2 receptor activity
- GO:0004913 interleukin-4 receptor activity
- GO:0004917 interleukin-7 receptor activity
- GO:0005515 protein binding
- GO:0015026 coreceptor activity
- GO:0019955 cytokine binding
- GO:0019976 interleukin-2 binding
- GO:0042010 interleukin-15 receptor activity
Biological Process
KEGG
- hsa04060 Cytokine-cytokine receptor interaction
- KEGG:hsa04061 Viral protein interaction with cytokine and cytokine receptor
- KEGG:hsa04144 Endocytosis
- KEGG:hsa04151 PI3K-Akt signaling pathway
- KEGG:hsa04630 JAK-STAT signaling pathway
- KEGG:hsa04658 Th1 and Th2 cell differentiation
- KEGG:hsa04659 Th17 cell differentiation
- KEGG:hsa05162 Measles
- KEGG:hsa05166 Human T-cell leukemia virus 1 infection
- KEGG:hsa05200 Pathways in cancer
- KEGG:hsa05321 Inflammatory bowel disease
- KEGG:hsa05340 Primary immunodeficiency
Reactome
- R-hsa-1280215 cytokine signaling in immune system
- R-hsa-8983432 interleukin 15 signaling
- R-hsa-9020958 interleukin 21 signaling
- R-hsa-451927 interleukin 2 family signaling
- R-hsa-9020558 interleukin 2 signaling
- R-hsa-512988 interleukin 3 interleukin 5 and gm csf signaling
- R-hsa-6785807 interleukin 4 and interleukin 13 signaling
- R-hsa-1266695 interleukin 7 signaling
- R-hsa-8985947 interleukin 9 signaling
- R-hsa-912526 interleukin receptor shc signaling
- R-hsa-5684996 mapk1 mapk3 signaling
- R-hsa-5683057 mapk family signaling cascades
- R-hsa-201556 signaling by alk
- R-hsa-449147 signaling by interleukins
- R-hsa-9006934 signaling by receptor tyrosine kinases
- R-hsa-9701898 stat3 nuclear events downstream of alk signaling
Canonical Pathways
- M274 Pid lymph angiogenesis pathway
- M47 Pid integrin cs pathway
- M240 Pid syndecan 2 pathway
Mediation Categories
Adhesion and uptake mediationClinical-translation mediationFusion and delivery mediationImmune mediationReceptor-signaling mediation
Relations & Evidence
Enzyme-Mediated Modification
0 records.
Ligand-Receptor Signaling
68 records.
| Category | Parent | Database | Transmitter | Receiver | Secreted | Plasma Membrane (Transmembrane) | Plasma Membrane (Peripheral) |
|---|---|---|---|---|---|---|---|
| cell_surface | cell_surface | Surfaceome | No | No | No | Yes | No |
| cell_surface | cell_surface | connectomeDB2020 | No | No | No | Yes | No |
| cell_surface | cell_surface | OmniPath | No | No | No | Yes | No |
| receptor | receptor | talklr | No | Yes | No | Yes | No |
| receptor | receptor | Cellinker | No | Yes | No | Yes | No |
| receptor | receptor | scConnect | No | Yes | No | Yes | No |
| receptor | receptor | connectomeDB2020 | No | Yes | No | Yes | No |
| receptor | receptor | CellCall | No | Yes | No | Yes | No |
| receptor | receptor | iTALK | No | Yes | No | Yes | No |
| cytokine | receptor | iTALK | No | Yes | No | Yes | No |
Regulatory Interaction Network
9 records.
Protein Complex Composition
4 records.
| Component Name | Component Gene Symbols | Component UniProt ID | Stoichiometry | Database | Database IDs | References |
|---|---|---|---|---|---|---|
| IL9_receptor | IL2RGIL9R | P31785Q01113 | 1:1 | Guide2PharmaCellChatDBCellPhoneDBICELLNETCellinker | CellPhoneDB:IL9_receptor | 15546386 |
| IL2RGIL4 | P05112P31785 | 2:2 | PDB | PDB:3qb7 | ||
| IL2RGPLP1REEP6 | P31785P60201Q96HR9 | 0:0:0 | hu.MAP2 | |||
| IL2RGREEP6 | P31785Q96HR9 | 0:0 | hu.MAPhu.MAP2 |
Sequence, Structure & Domains
Sequences
Length
369
Mass
42,287
Sequence
MLKPSLPFTSLLFLQLPLLGVGLNTTILTPNGNEDTTADFFLTTMPTDSLSVSTLPLPEVQCFVFNVEYMNCTWNSSSEPQPTNLTLHYWYKNSDNDKVQKCSHYLFSEEITSGCQLQKKEIHLYQTFVVQLQDPREPRRQATQMLKLQNLVIPWAPENLTLHKLSESQLELNWNNRFLNHCLEHLVQYRTDWDHSWTEQSVDYRHKFSLPSVDGQKRYTFRVRSRFNPLCGSAQHWSEWSHPIHWGSNTSKENPFLFALEAVVISVGSMGLIISLLCVYFWLERTMPRIPTLKNLEDLVTEYHGNFSAWSGVSKGLAESLQPDYSERLCLVSEIPPKGGALGEGPGASPCNQHSPYWAPPCYTLKPET
Alternative Products
Event=Alternative splicing; Named isoforms=2; Name=1; IsoId=P31785-1; Sequence=Displayed; Name=2; IsoId=P31785-2; Sequence=VSP_047581, VSP_047582
Alternative Sequence
1..8; MLKPSLPF -> MGMKTPQL (in isoform 2); 9..198; Missing (in isoform 2)
3D Structural Models
Turn
66..68
Helix
119..121; 148..150; 180..182
Beta Strand
61..65; 69..73; 78..81; 86..91; 94..96; 99..101; 103..108; 111..118; 124..126; 128..133; 135..137; 141..146; 151..153; 158..166; 169..175; 184..191; 198..202; 207..210; 215..217; 219..226; 229..231; 244..246
3D Structure
Electron microscopy (2); X-ray crystallography (10)
Domain & Motif Annotations
Motif
237..241; WSXWS motif; 286..294; Box 1 motif
Domain (CC)
The WSXWS motif appears to be necessary for proper protein folding and thereby efficient intracellular transport and cell-surface receptor binding.; DOMAIN: The box 1 motif is required for JAK interaction and/or activation.
Domain (FT)
156..253; Fibronectin type-III
Protein Families
- Type I cytokine receptor family
- Type 5 subfamily
Sequence Similarities
Belongs to the type I cytokine receptor family. Type 5 subfamily.
Clinical Relevance
Disease Involvement
Cancer-related genesDisease variantFDA approved drug targetsSCID
Drug Targets
FDA approved drug targets
Drugs