Protein detail
STIP1
Stress-induced-phosphoprotein 1 (STI1) (Hsc70/Hsp90-organizing protein) (Hop) (Renal carcinoma antigen NY-REN-11) (Transformation-sensitive protein IEF SSP 3521)
Entry name STIP1 | UniProt ID | EVMP confidence score 0.38 |
Supporting publications (n) 1 | Transmembrane count | Protein classification Plasma proteinsPredicted intracellular proteins |
EVMP confidence score
Annotation confidence score; open for threshold definitions.
Extremely high >= 0.85High >= 0.70Medium >= 0.55Low >= 0.40Basic Information11
Protein Names
Stress-induced-phosphoprotein 1 (STI1) (Hsc70/Hsp90-organizing protein) (Hop) (Renal carcinoma antigen NY-REN-11) (Transformation-sensitive protein IEF SSP 3521)
Protein Class (2)
Plasma proteinsPredicted intracellular proteins
Protein Function
Predicted intracellular proteins
Ensembl
Entrez Gene Symbol
Gene Synonym (2)
HOPSTI1
Gene Description
Stress induced phosphoprotein 1
Chromosome
11
Position
64185272-64204543
Supporting publications (n)
1
EVMP confidence score
0.38
Fluorescence & Localization4
Tissue Specificbone marrowCell SpecificErythrocyte progenitorsSingle-Nuclei Brain Specificcentral nervous system macrophage
Function & Pathway8
Protein Function
Predicted intracellular proteins
Cellular Component (6)
Molecular Function (3)
Biological Process (3)
Reactome (5)
Canonical Pathways
M54 Pid il12 2pathway
Mediation Categories
Receptor-signaling mediation
Relations & Evidence29
Enzyme-Mediated Modification (8)
8 records.
| Substrate Gene Symbol | Enzyme Gene Symbol | Enzyme UniProt ID | Residue Type | Residue Offset | Modification | Database | References |
|---|---|---|---|---|---|---|---|
| STIP1 | CDK1 | P06493 | T | 198 | phosphorylation | REACH_ProtMapperSIGNORSparser_ProtMapperProtMapper | ProtMapper:27515256ProtMapper:28559789SIGNOR:14754904 |
| STIP1 | CDK1 | P06493 | T | 332 | phosphorylation | SIGNOR | SIGNOR:14754904 |
| STIP1 | CDK1 | P06493 | S | 189 | phosphorylation | SIGNOR | SIGNOR:14754904 |
| STIP1 | DYRK4 | Q9NR20 | T | 198 | phosphorylation | PhosphoNetworks | |
| STIP1 | TNNI3K | Q59H18 | Y | 354 | phosphorylation | PhosphoNetworks | |
| STIP1 | MAP4K2 | Q12851 | S | 481 | phosphorylation | PhosphoNetworks | |
| STIP1 | RPS6KA1 | Q15418 | S | 189 | phosphorylation | Sparser_ProtMapperProtMapper | ProtMapper:22804236 |
| STIP1 | CSNK2A1 | P68400 | S | 189 | phosphorylation | KEA | KEA:11154072 |
Ligand-Receptor Signaling (4)
4 records.
| Category | Parent | Database | Transmitter | Receiver | Secreted | Plasma Membrane (Transmembrane) | Plasma Membrane (Peripheral) |
|---|---|---|---|---|---|---|---|
| intracellular | intracellular | ComPPI | No | No | No | No | No |
| intracellular | intracellular | GO_Intercell | No | No | No | No | No |
| intracellular | intracellular | UniProt_location | No | No | No | No | No |
| intracellular | intracellular | OmniPath | No | No | No | No | No |
Regulatory Interaction Network (3)
3 records.
Protein Complex Composition (13)
13 records.
| Component Name | Component Gene Symbols | Component UniProt ID | Stoichiometry | Database | Database IDs | References |
|---|---|---|---|---|---|---|
| DNAJA2STIP1 | O60884P31948 | 0:0 | hu.MAP | |||
| EEF1A1HSPA14STIP1SUMO4UBCZPR1 | O75312P0CG48P31948P68104Q0VDF9Q6EEV6 | 1:1:1:1:1:1 | NetworkBlastCompleat | Compleat:HC6919 | ||
| HSP90AA1HSPA1ANR3C1STIP1 | P04150P07900P0DMV8P31948 | 1:2:2:1 | PDB | PDB:7kw7 | ||
| DNAJC2HSPA14HSPA4STIP1UBCWDR6 | P0CG48P31948P34932Q0VDF9Q99543Q9NNW5 | 1:1:1:1:1:1 | NetworkBlastCompleat | Compleat:HC4888 | ||
| HSPA1AHSPH1STIP1 | P0DMV8P31948Q92598 | 0:0:0 | hu.MAP | |||
| HSPA1BNUFIP1PTGES3STIP1WIPI2 | P0DMV9P31948Q15185Q9UHK0Q9Y4P8 | 1:1:1:1:1 | NetworkBlastCompleat | Compleat:HC8072 | ||
| HSPA1BHSPH1STIP1 | P0DMV9P31948Q92598 | 0:0:0 | hu.MAP | |||
| HSPA8NASPSTIP1STMN1VCP | P11142P16949P31948P49321P55072 | 0:0:0:0:0 | Havugimana2012 | Havugimana2012:C_474 | ||
| HSPA8STIP1 | P11142P31948 | 1:1 | PDB | PDB:3esk | ||
| STIP1 | P31948 | 2 | PDB | PDB:1elw |
Page 1 of 2Next
Isolation & Detection Technology (1)
1 record.
| EV Isolation Method | Detection Method | Number of References | References |
|---|---|---|---|
| Differential UltracentrifugationSize Exclusion Chromatography | Mass spectrometry [LTQ-FT Ultra] | 1 | 30550287 |
Sequence, Structure & Domains14
Sequences
Length
543
Mass
62,639
Sequence
MEQVNELKEKGNKALSVGNIDDALQCYSEAIKLDPHNHVLYSNRSAAYAKKGDYQKAYEDGCKTVDLKPDWGKGYSRKAAALEFLNRFEEAKRTYEEGLKHEANNPQLKEGLQNMEARLAERKFMNPFNMPNLYQKLESDPRTRTLLSDPTYRELIEQLRNKPSDLGTKLQDPRIMTTLSVLLGVDLGSMDEEEEIATPPPPPPPKKETKPEPMEEDLPENKKQALKEKELGNDAYKKKDFDTALKHYDKAKELDPTNMTYITNQAAVYFEKGDYNKCRELCEKAIEVGRENREDYRQIAKAYARIGNSYFKEEKYKDAIHFYNKSLAEHRTPDVLKKCQQAEKILKEQERLAYINPDLALEEKNKGNECFQKGDYPQAMKHYTEAIKRNPKDAKLYSNRAACYTKLLEFQLALKDCEECIQLEPTFIKGYTRKAAALEAMKDYTKAMDVYQKALDLDSSCKEAADGYQRCMMAQYNRHDSPEDVKRRAMADPEVQQIMSDPAMRLILEQMQKDPQALSEHLKNPVIAQKIQKLMDVGLIAIR
Alternative Products
Event=Alternative splicing; Named isoforms=3; Name=1; IsoId=P31948-1; Sequence=Displayed; Name=2; IsoId=P31948-2; Sequence=VSP_055034; Name=3; IsoId=P31948-3; Sequence=VSP_055035
Alternative Sequence
1..3; MEQ -> MESGSPMGEVEISRTIRTNGRGQRGYDWQCKRPIRVAEVRSSLHSWSLRW (in isoform 2); 74..97; Missing (in isoform 3)
3D Structural Models
Turn
405..408
Helix
3..16; 20..33; 38..51; 54..67; 72..84; 88..99; 106..117; 223..237; 241..254; 259..272; 275..291; 296..312; 316..329; 333..348; 359..372; 377..387; 394..404; 410..423; 428..440; 444..457; 459..462; 463..475
3D Structure
Electron microscopy (1); NMR spectroscopy (2); X-ray crystallography (4)
Domain & Motif Annotations
Compositional Bias
205..233; Basic and acidic residues
Repeat
4..37; TPR 1; 38..71; TPR 2; 72..105; TPR 3; 225..258; TPR 4; 259..292; TPR 5; 300..333; TPR 6; 360..393; TPR 7; 394..427; TPR 8; 428..461; TPR 9
Motif
222..239; Bipartite nuclear localization signal
Domain (CC)
The TPR 1 repeat interacts with the C-terminal of HSC70. The TPR 4, 5 and 6 repeats (also called TPR2A domain) and TPR 7, 8 and 9 repeats (also called TPR2B domain) interact with HSP90.
Domain (FT)
130..169; STI1 1; 492..531; STI1 2
Region
192..233; Disordered
Clinical Relevance4
Interaction Protein (13)
ENSG00000011485ENSG00000080824ENSG00000096060ENSG00000096384ENSG00000105701ENSG00000105993ENSG00000106993ENSG00000109971ENSG00000120694ENSG00000141510ENSG00000159873ENSG00000168259ENSG00000170606
Interaction Count
13
Interaction Dataset (4)
intact_biogridintact_biogrid_opencellbiogrid_opencellintact_biogrid_opencell_bioplex
Supporting Publications1
| PMID | Title | Abstract |
|---|---|---|
| 31414377 | Global extracellular vesicle proteomic signature defines U87-MG glioma cell hypoxic status with potential implications for non-invasive diagnostics. | No abstract available |