Protein detail

STIP1

Stress-induced-phosphoprotein 1 (STI1) (Hsc70/Hsp90-organizing protein) (Hop) (Renal carcinoma antigen NY-REN-11) (Transformation-sensitive protein IEF SSP 3521)

Protein symbol STIP1	UniProt ID P31948	EVMP score 0.38
Frequency 1	Transmembrane count	Protein classification Plasma proteinsPredicted intracellular proteins

EVMP score: annotation confidence score.

Extremely high >= 0.85High >= 0.70Medium >= 0.55Low >= 0.40

Basic Information

Protein Names

Stress-induced-phosphoprotein 1 (STI1) (Hsc70/Hsp90-organizing protein) (Hop) (Renal carcinoma antigen NY-REN-11) (Transformation-sensitive protein IEF SSP 3521)

Protein Class

Plasma proteinsPredicted intracellular proteins

Protein Function

Predicted intracellular proteins

Ensembl

ENSG00000168439

Entrez Gene Symbol

STIP1

Gene Synonym

HOPSTI1

Gene Description

Stress induced phosphoprotein 1

Chromosome

Position

64185272-64204543

Frequency

EVMP Score

0.38

Fluorescence & Localization

Tissue Specificbone marrowCell SpecificErythrocyte progenitorsSingle-Nuclei Brain Specificcentral nervous system macrophage

Function & Pathway

Protein Function

Predicted intracellular proteins

Cellular Component

Molecular Function

Biological Process

KEGG

hsa05020 Prion disease

Reactome

Canonical Pathways

M54 Pid il12 2pathway

Mediation Categories

Receptor-signaling mediation

Relations & Evidence

Enzyme-Mediated Modification

8 records.

Substrate Gene Symbol	Enzyme Gene Symbol	Enzyme UniProt ID	Residue Type	Residue Offset	Modification	Database	References
STIP1	CDK1	P06493	T	198	phosphorylation	REACH_ProtMapperSIGNORSparser_ProtMapperProtMapper	ProtMapper:27515256 ProtMapper:28559789 SIGNOR:14754904
STIP1	CDK1	P06493	T	332	phosphorylation	SIGNOR	SIGNOR:14754904
STIP1	CDK1	P06493	S	189	phosphorylation	SIGNOR	SIGNOR:14754904
STIP1	DYRK4	Q9NR20	T	198	phosphorylation	PhosphoNetworks
STIP1	TNNI3K	Q59H18	Y	354	phosphorylation	PhosphoNetworks
STIP1	MAP4K2	Q12851	S	481	phosphorylation	PhosphoNetworks
STIP1	RPS6KA1	Q15418	S	189	phosphorylation	Sparser_ProtMapperProtMapper	ProtMapper:22804236
STIP1	CSNK2A1	P68400	S	189	phosphorylation	KEA	KEA:11154072

Ligand-Receptor Signaling

4 records.

Category	Parent	Database	Transmitter	Receiver	Secreted	Plasma Membrane (Transmembrane)	Plasma Membrane (Peripheral)
intracellular	intracellular	ComPPI	No	No	No	No	No
intracellular	intracellular	GO_Intercell	No	No	No	No	No
intracellular	intracellular	UniProt_location	No	No	No	No	No
intracellular	intracellular	OmniPath	No	No	No	No	No

Regulatory Interaction Network

3 records.

Source Protein Symbol	Source UniProt ID	Target Protein Symbol	Target UniProt ID	Is Directed	Is Stimulation	Is Inhibition	Database	References
CDK1	P06493	STIP1	P31948	Yes	No	Yes	Sparser_ProtMapperiPTMnetSIGNORProtMapperSIGNOR_ProtMapperREACH_ProtMapper	ProtMapper:14754904 ProtMapper:27515256 ProtMapper:31466231 SIGNOR:14754904 ProtMapper:28559789
STIP1	P31948	HS90B	P08238	Yes	No	Yes	DIPHINTSIGNORIntAct	HINT:35271311 HINT:18285346 SIGNOR:27353360 IntAct:21170051 DIP:21170051 HINT:21170051
STIP1	P31948	HS90A	P07900	Yes	No	Yes	SIGNORHPRDHINTBioGRIDLMPIDLit-BM-17	HINT:21235734 Lit-BM-17:22315411 HINT:10642522 HINT:21360678 Lit-BM-17:20704274 HINT:34937942 Lit-BM-17:22504172 LMPID:16531226 HINT:24949977 Lit-BM-17:10642522 Lit-BM-17:10786835 Lit-BM-17:19996313 Lit-BM-17:20159553 HINT:10786835 LMPID:10567422 HINT:35760815 Lit-BM-17:22729780 Lit-BM-17:26496610 Lit-BM-17:24462205 HINT:20704274 Lit-BM-17:11413142 Lit-BM-17:11877417 Lit-BM-17:18285346 HPRD:10786835 LMPID:10786835 HINT:35271311 LMPID:11877417 BioGRID:10786835 HINT:22504172 HINT:18285346 SIGNOR:27353360 Lit-BM-17:21170051 Lit-BM-17:9452498 HINT:26496610 HINT:11877417 HINT:33961781 Lit-BM-17:26804907 Lit-BM-17:21235734 Lit-BM-17:21360678 Lit-BM-17:25036637 Lit-BM-17:24949977 HINT:15782202 Lit-BM-17:19875381 HINT:21170051

Protein Complex Composition

13 records.

Component Gene Symbols	Component UniProt ID	Stoichiometry	Database	Database IDs
GPX4 STIP1 TWF1	P31948 P36969 Q12792	0:0:0	hu.MAP2
STIP1 TWF1	P31948 Q12792	0:0	hu.MAP2
Q9H2A1 STIP1	P31948 Q9H2A1	1:1	PDB	PDB:1elr

Page 2 of 2Previous

Isolation & Detection Technology

1 record.

EV Isolation Method	Detection Method	Number of References	References
Differential UltracentrifugationSize Exclusion Chromatography	Mass spectrometry [LTQ-FT Ultra]	1	30550287

Sequence, Structure & Domains

Sequences

Length

543

Mass

62,639

Sequence

MEQVNELKEKGNKALSVGNIDDALQCYSEAIKLDPHNHVLYSNRSAAYAKKGDYQKAYEDGCKTVDLKPDWGKGYSRKAAALEFLNRFEEAKRTYEEGLKHEANNPQLKEGLQNMEARLAERKFMNPFNMPNLYQKLESDPRTRTLLSDPTYRELIEQLRNKPSDLGTKLQDPRIMTTLSVLLGVDLGSMDEEEEIATPPPPPPPKKETKPEPMEEDLPENKKQALKEKELGNDAYKKKDFDTALKHYDKAKELDPTNMTYITNQAAVYFEKGDYNKCRELCEKAIEVGRENREDYRQIAKAYARIGNSYFKEEKYKDAIHFYNKSLAEHRTPDVLKKCQQAEKILKEQERLAYINPDLALEEKNKGNECFQKGDYPQAMKHYTEAIKRNPKDAKLYSNRAACYTKLLEFQLALKDCEECIQLEPTFIKGYTRKAAALEAMKDYTKAMDVYQKALDLDSSCKEAADGYQRCMMAQYNRHDSPEDVKRRAMADPEVQQIMSDPAMRLILEQMQKDPQALSEHLKNPVIAQKIQKLMDVGLIAIR

Alternative Products

Event=Alternative splicing; Named isoforms=3; Name=1; IsoId=P31948-1; Sequence=Displayed; Name=2; IsoId=P31948-2; Sequence=VSP_055034; Name=3; IsoId=P31948-3; Sequence=VSP_055035

Alternative Sequence

1..3; MEQ -> MESGSPMGEVEISRTIRTNGRGQRGYDWQCKRPIRVAEVRSSLHSWSLRW (in isoform 2); 74..97; Missing (in isoform 3)

3D Structural Models

Turn

405..408

Helix

3..16; 20..33; 38..51; 54..67; 72..84; 88..99; 106..117; 223..237; 241..254; 259..272; 275..291; 296..312; 316..329; 333..348; 359..372; 377..387; 394..404; 410..423; 428..440; 444..457; 459..462; 463..475

3D Structure

Electron microscopy (1); NMR spectroscopy (2); X-ray crystallography (4)

Domain & Motif Annotations

Compositional Bias

205..233; Basic and acidic residues

Repeat

4..37; TPR 1; 38..71; TPR 2; 72..105; TPR 3; 225..258; TPR 4; 259..292; TPR 5; 300..333; TPR 6; 360..393; TPR 7; 394..427; TPR 8; 428..461; TPR 9

Motif

222..239; Bipartite nuclear localization signal

Domain (CC)

The TPR 1 repeat interacts with the C-terminal of HSC70. The TPR 4, 5 and 6 repeats (also called TPR2A domain) and TPR 7, 8 and 9 repeats (also called TPR2B domain) interact with HSP90.

Domain (FT)

130..169; STI1 1; 492..531; STI1 2

Region

192..233; Disordered

Clinical Relevance

Antibody

CAB017448 HPA039291 HPA044062

Interaction Protein

ENSG00000011485ENSG00000080824ENSG00000096060ENSG00000096384ENSG00000105701ENSG00000105993ENSG00000106993ENSG00000109971ENSG00000120694ENSG00000141510ENSG00000159873ENSG00000168259ENSG00000170606

Interaction Count

Interaction Dataset

intact_biogridintact_biogrid_opencellbiogrid_opencellintact_biogrid_opencell_bioplex