Protein detail
CD70
CD70 antigen (CD27 ligand) (CD27-L) (Tumor necrosis factor ligand superfamily member 7) (CD antigen CD70)
Entry name CD70 | UniProt ID | EVMP confidence score 0.25 |
Supporting publications (n) 2 | Transmembrane count 1 | Protein classification |
EVMP confidence score
Annotation confidence score; open for threshold definitions.
Extremely high >= 0.85High >= 0.70Medium >= 0.55Low >= 0.40Basic Information8
Protein Names
CD70 antigen (CD27 ligand) (CD27-L) (Tumor necrosis factor ligand superfamily member 7) (CD antigen CD70)
Protein Function (6)
- Predicted intracellular proteins
- Cancer-related genes:Mutated cancer genes
- CD markers
- Human disease related genes:Immune system diseases:Primary immunodeficiency
- Cancer-related genes:Candidate cancer biomarkers
- Disease related genes
Transmembrane
18..38; Helical; Signal-anchor for type II membrane protein
Transmembrane Count
1
Ensembl
Entrez Gene Symbol
Supporting publications (n)
2
EVMP confidence score
0.25
Fluorescence & Localization5
Tissue Specificstomach 1Brain Regional SpecificcerebellumCell SpecificCholangiocytesSingle-Nuclei Brain Specificupper rhombic lip
Function & Pathway7
Protein Function (6)
- Predicted intracellular proteins
- Cancer-related genes:Mutated cancer genes
- CD markers
- Human disease related genes:Immune system diseases:Primary immunodeficiency
- Cancer-related genes:Candidate cancer biomarkers
- Disease related genes
Cellular Component (2)
Molecular Function (3)
Biological Process (3)
Reactome (3)
Mediation Categories (3)
Adhesion and uptake mediationImmune mediationReceptor-signaling mediation
Relations & Evidence52
Ligand-Receptor Signaling (50)
50 records.
| Category | Parent | Database | Transmitter | Receiver | Secreted | Plasma Membrane (Transmembrane) | Plasma Membrane (Peripheral) |
|---|---|---|---|---|---|---|---|
| adhesion | adhesion | OmniPath | Yes | Yes | Yes | No | No |
| cell_adhesion | cell_adhesion | OmniPath | Yes | Yes | Yes | No | No |
| transmembrane | transmembrane | UniProt_location | No | No | Yes | No | No |
| transmembrane | transmembrane | UniProt_topology | No | No | Yes | No | No |
| transmembrane | transmembrane | UniProt_keyword | No | No | Yes | No | No |
| transmembrane_predicted | transmembrane | OmniPath | No | No | Yes | No | No |
| transmembrane | transmembrane | TopDB | No | No | Yes | No | No |
| transmembrane | transmembrane | LOCATE | No | No | Yes | No | No |
| transmembrane | transmembrane | Ramilowski_location | No | No | Yes | No | No |
| transmembrane | transmembrane | OmniPath | No | No | Yes | No | No |
Regulatory Interaction Network (1)
1 record.
Isolation & Detection Technology (1)
1 record.
| EV Isolation Method | Detection Method | Number of References | References |
|---|---|---|---|
| Differential UltracentrifugationSize Exclusion Chromatography | Mass spectrometry | 1 | 30865381 |
Sequence, Structure & Domains12
Sequences
Length
193
Mass
21,118
Sequence
MPEEGSGCSVRRRPYGCVLRAALVPLVAGLVICLVVCIQRFAQAQQQLPLESLGWDVAELQLNHTGPQQDPRLYWQGGPALGRSFLHGPELDKGQLRIHRDGIYMVHIQVTLAICSSTTASRHHPTTLAVGICSPASRSISLLRLSFHQGCTIASQRLTPLARGDTLCTNLTGTLLPSRNTDETFFGVQWVRP
Alternative Products
Event=Alternative splicing; Named isoforms=2; Name=1; IsoId=P32970-1; Sequence=Displayed; Name=2; IsoId=P32970-2; Sequence=VSP_056416
Alternative Sequence
151..193; CTIASQRLTPLARGDTLCTNLTGTLLPSRNTDETFFGVQWVRP -> LFGFWNWGLKVKCFLRHLIWTAHCFIPLTQLVFMQALQSWRNHHCSHFTDEENRGVNR (in isoform 2)
3D Structural Models
Turn
79..81; 181..183
Helix
117..122
Beta Strand
57..65; 72..76; 85..88; 90..92; 95..97; 102..112; 127..132; 134..136; 141..146; 151..161; 166..174; 185..192
3D Structure
X-ray crystallography (1)
Domain & Motif Annotations
Domain (FT)
56..191; THD
Protein Families
Tumor necrosis factor family
Sequence Similarities
Belongs to the tumor necrosis factor family.
Clinical Relevance1
Supporting Publications2
| PMID | Title | Abstract |
|---|---|---|
| 26801919 | Exosomes Secreted by Apoptosis-Resistant Acute Myeloid Leukemia (AML) Blasts Harbor Regulatory Network Proteins Potentially Involved in Antagonism of Apoptosis. | No abstract available |
| 32795414 | Extracellular Vesicle and Particle Biomarkers Define Multiple Human Cancers. | Among traditional exosome markers, CD9, HSPA8, ALIX, and HSP90AB1 represent pan-EVP markers, while ACTB, MSN, and RAP1B are novel pan-EVP markers. |