Protein detail

CNR2

Cannabinoid receptor 2 (CB-2) (CB2) (hCB2) (CX5)

Entry name CNR2	UniProt ID P34972	EVMP confidence score 0.25
Supporting publications (n) 2	Transmembrane count 7	Protein classification FDA approved drug targetsG-protein coupled receptorsPredicted membrane proteinsTransporters

EVMP confidence score

Annotation confidence score; open for threshold definitions.

Extremely high >= 0.85High >= 0.70Medium >= 0.55Low >= 0.40

Basic Information13

Protein Names

Cannabinoid receptor 2 (CB-2) (CB2) (hCB2) (CX5)

Protein Class (4)

FDA approved drug targetsG-protein coupled receptorsPredicted membrane proteinsTransporters

Protein Function (3)

Transporters
FDA approved drug targets:Small molecule drugs
G-protein coupled receptors:GPCRs excl olfactory receptors

Transmembrane

34..59; Helical; Name=1; 72..92; Helical; Name=2; 105..129; Helical; Name=3; 150..172; Helical; Name=4; 189..214; Helical; Name=5; 247..267; Helical; Name=6; 280..301; Helical; Name=7

Transmembrane Count

Ensembl

ENSG00000188822

Entrez Gene Symbol

CNR2

Gene Synonym

CB2

Gene Description

Cannabinoid receptor 2

Chromosome

Position

23870515-23913362

Supporting publications (n)

EVMP confidence score

0.25

Fluorescence & Localization4

Tissue Specificchoroid plexusBrain Regional Specificchoroid plexusCell SpecificEndometrial ciliated cellsSingle-Nuclei Brain Specificependymal cell

Function & Pathway7

Protein Function (3)

Transporters
FDA approved drug targets:Small molecule drugs
G-protein coupled receptors:GPCRs excl olfactory receptors

Cellular Component (7)

Molecular Function (2)

Biological Process (3)

KEGG

hsa04080 Neuroactive ligand-receptor interaction

Reactome (4)

Mediation Categories (3)

Clinical-translation mediationImmune mediationReceptor-signaling mediation

Relations & Evidence53

Enzyme-Mediated Modification (1)

1 record.

Substrate Gene Symbol	Enzyme Gene Symbol	Enzyme UniProt ID	Residue Type	Residue Offset	Modification	Database	References
CNR2	GRK1	Q15835	S	352	phosphorylation	KEA	KEA:10400664

Ligand-Receptor Signaling (46)

46 records.

Category	Parent	Database	Transmitter	Receiver	Secreted	Plasma Membrane (Transmembrane)	Plasma Membrane (Peripheral)
7tm_a	receptor	HPMR	No	Yes	No	Yes	No
lysosphingolipid_lysophosphatidic_acid_edg_7tm_a	receptor	HPMR	No	Yes	No	Yes	No
rhodopsin	receptor	Surfaceome	No	Yes	No	Yes	No
gpcr	receptor	Surfaceome	No	Yes	No	Yes	No
class_a_rhodopsin	receptor	GPCRdb	No	Yes	No	Yes	No
class_a_rhodopsin_lipid	receptor	GPCRdb	No	Yes	No	Yes	No
class_a_rhodopsin_lipid_cannabinoid	receptor	GPCRdb	No	Yes	No	Yes	No
receptor	receptor	OmniPath	No	Yes	No	Yes	No
extracellular	extracellular	HPMR	No	No	No	Yes	No
extracellular	extracellular	OmniPath	No	No	No	Yes	No

Page 2 of 5Previous Next

Regulatory Interaction Network (5)

5 records.

Source Protein Symbol	Source UniProt ID	Target Protein Symbol	Target UniProt ID	Is Directed	Is Stimulation	Is Inhibition	Database	References
CNR2	P34972	GNAI3	P08754	Yes	Yes	No	WangCui2007SIGNORCA1	CA1:15082510 SIGNOR:31160049
CNR2	P34972	GNAO	P09471	Yes	Yes	No	WangCui2007SIGNORCA1	CA1:15082510 SIGNOR:31160049
CNR2	P34972	GNAZ	P19086	Yes	Yes	No	SIGNOR	SIGNOR:31160049
MLKL	Q8NB16	CNR2	P34972	Yes	No	Yes	SIGNOR	SIGNOR:10400664 SIGNOR:36448459
CNR2	P34972	GNAI1	P63096	Yes	Yes	No	HINTSIGNOR	SIGNOR:31160049 HINT:32004460 HINT:32004463 HINT:36922494

Isolation & Detection Technology (1)

1 record.

EV Isolation Method	Detection Method	Number of References	References
	Mass spectrometry	0

Sequence, Structure & Domains11

Sequences

Length

360

Mass

39,681

Sequence

MEECWVTEIANGSKDGLDSNPMKDYMILSGPQKTAVAVLCTLLGLLSALENVAVLYLILSSHQLRRKPSYLFIGSLAGADFLASVVFACSFVNFHVFHGVDSKAVFLLKIGSVTMTFTASVGSLLLTAIDRYLCLRYPPSYKALLTRGRALVTLGIMWVLSALVSYLPLMGWTCCPRPCSELFPLIPNDYLLSWLLFIAFLFSGIIYTYGHVLWKAHQHVASLSGHQDRQVPGMARMRLDVRLAKTLGLVLAVLLICWFPVLALMAHSLATTLSDQVKKAFAFCSMLCLINSMVNPVIYALRSGEIRSSAHHCLAHWKKCVRGLGSEAKEEAPRSSVTETEADGKITPWPDSRDLDLSDC

3D Structural Models

Turn

95..97; 224..226

Helix

22..24; 31..60; 62..65; 68..94; 103..136; 138..144; 147..165; 168..170; 188..219; 220..223; 230..233; 238..270; 275..284; 287..302; 304..318

Beta Strand

175..177; 181..183

3D Structure

Electron microscopy (7); NMR spectroscopy (1); X-ray crystallography (2)

Domain & Motif Annotations

Compositional Bias

351..360; Basic and acidic residues

Region

327..360; Disordered

Protein Families

G-protein coupled receptor 1 family

Sequence Similarities

Belongs to the G-protein coupled receptor 1 family.

Clinical Relevance7

Disease Involvement

FDA approved drug targets

Drug Targets

FDA approved drug targets

Antibody

CAB009719

Interaction Protein

ENSG00000161011

Interaction Count

Interaction Dataset

intact_biogrid

Supporting Publications2

PMID	Title	Abstract
30915084	Extracellular Vesicles Mediate Mesenchymal Stromal Cell-Dependent Regulation of B Cell PI3K-AKT Signaling Pathway and Actin Cytoskeleton.	No abstract available
38014595	Proteome and immune responses of extracellular vesicles derived from macrophages infected with the periodontal pathogen Tannerella forsythia.	No abstract available