Protein detail
GPC1
Glypican-1 [Cleaved into: Secreted glypican-1]
Entry name GPC1 | UniProt ID | EVMP confidence score 0.50 |
Supporting publications (n) 4 | Transmembrane count | Protein classification |
EVMP confidence score
Annotation confidence score; open for threshold definitions.
Extremely high >= 0.85High >= 0.70Medium >= 0.55Low >= 0.40Basic Information6
Protein Names
Glypican-1 [Cleaved into: Secreted glypican-1]
Protein Function (2)
- Disease related genes
- Predicted intracellular proteins
Ensembl
Entrez Gene Symbol
Supporting publications (n)
4
EVMP confidence score
0.50
Fluorescence & Localization2
Cell SpecificNeutrophils
Function & Pathway8
Protein Function (2)
- Disease related genes
- Predicted intracellular proteins
Cellular Component (15)
- GO:0005576 extracellular region
- GO:0005615 extracellular space
- GO:0005654 nucleoplasm
- GO:0005768 endosome
- GO:0005796 Golgi lumen
- GO:0005829 cytosol
- GO:0005886 plasma membrane
- GO:0009986 cell surface
- GO:0031012 extracellular matrix
- GO:0043202 lysosomal lumen
Page 1 of 2
Molecular Function (4)
Biological Process (3)
Reactome (31)
- R-hsa-9694614 attachment and entry
- R-hsa-202733 cell surface interactions at the vascular wall
- R-hsa-3560783 defective b4galt7 causes eds progeroid type
- R-hsa-3656237 defective ext2 causes exostoses 2
- R-hsa-9918485 dengue virus attachment and entry
- R-hsa-9918481 dengue virus host interactions
- R-hsa-9839923 dengue virus infection
- R-hsa-3560782 diseases associated with glycosaminoglycan metabolism
- R-hsa-3781865 diseases of glycosylation
- R-hsa-5668914 diseases of metabolism
Page 1 of 4
Canonical Pathways (3)
- M83 Pid cdc42 reg pathway
- M241 Pid rac1 reg pathway
- M71 Pid ilk pathway
Mediation Categories (5)
Clinical-translation mediationFusion and delivery mediationImmune mediationMetabolism mediationReceptor-signaling mediation
Relations & Evidence56
Ligand-Receptor Signaling (51)
51 records.
| Category | Parent | Database | Transmitter | Receiver | Secreted | Plasma Membrane (Transmembrane) | Plasma Membrane (Peripheral) |
|---|---|---|---|---|---|---|---|
| plasma_membrane | plasma_membrane | UniProt_location | No | No | Yes | Yes | Yes |
| plasma_membrane | plasma_membrane | Cellinker | No | No | Yes | Yes | Yes |
| plasma_membrane | plasma_membrane | OmniPath | No | No | Yes | Yes | Yes |
| plasma_membrane_transmembrane | plasma_membrane_transmembrane | CSPA | No | No | Yes | Yes | Yes |
| plasma_membrane_transmembrane | plasma_membrane_transmembrane | OmniPath | No | No | Yes | Yes | Yes |
| plasma_membrane_peripheral | plasma_membrane_peripheral | CSPA | No | No | Yes | Yes | Yes |
| plasma_membrane_peripheral | plasma_membrane_peripheral | OmniPath | No | No | Yes | Yes | Yes |
| secreted | secreted | UniProt_keyword | No | No | Yes | Yes | Yes |
| secreted | secreted | OmniPath | No | No | Yes | Yes | Yes |
| cell_surface | cell_surface | Surfaceome | No | No | Yes | Yes | Yes |
Regulatory Interaction Network (2)
2 records.
| Source Protein Symbol | Source UniProt ID | Target Protein Symbol | Target UniProt ID | Is Directed | Is Stimulation | Is Inhibition | Database | References |
|---|---|---|---|---|---|---|---|---|
| SLIT2 | O94813 | GPC1 | P35052 | Yes | Yes | No | Fantom5_LRdbCellTalkDBHPMR_LRdbHPRD_LRdbiTALKHPMR_CellinkertalklrRamilowski2015SIGNORconnectomeDB2020HPRDHPRD_talklrCellinkerWangLRdbSTRING_talklrHPMR_talklr | LRdb:10364234Cellinker:11375980HPRD:10364234Cellinker:29317497SIGNOR:10364234connectomeDB2020:11375980Cellinker:10364234LRdb:11375980connectomeDB2020:10364234CellTalkDB:11375980HPRD:11375980 |
| SLIT1 | O75093 | GPC1 | P35052 | Yes | Yes | No | iTALKSIGNORHPMR_talklrHPRD_LRdbtalklrHPRDRamilowski2015_Baccin2019WangRamilowski2015HPMR_LRdbHPRD_talklrBaccin2019CellinkerEMBRACEFantom5_LRdbCellTalkDBHPMR_CellinkerconnectomeDB2020SPIKE_LCLRdb | Baccin2019:1036423410364230LRdb:10364234CellTalkDB:10364234HPRD:10364234SIGNOR:10364234SPIKE_LC:16713569connectomeDB2020:10364234Cellinker:10364234 |
Protein Complex Composition (2)
Isolation & Detection Technology (1)
1 record.
| EV Isolation Method | Detection Method | Number of References | References |
|---|---|---|---|
| Differential Ultracentrifugation | Western blotting | 1 | 37922300 |
Sequence, Structure & Domains13
Sequences
Length
558
Mass
61,680
Sequence
MELRARGWWLLCAAAALVACARGDPASKSRSCGEVRQIYGAKGFSLSDVPQAEISGEHLRICPQGYTCCTSEMEENLANRSHAELETALRDSSRVLQAMLATQLRSFDDHFQHLLNDSERTLQATFPGAFGELYTQNARAFRDLYSELRLYYRGANLHLEETLAEFWARLLERLFKQLHPQLLLPDDYLDCLGKQAEALRPFGEAPRELRLRATRAFVAARSFVQGLGVASDVVRKVAQVPLGPECSRAVMKLVYCAHCLGVPGARPCPDYCRNVLKGCLANQADLDAEWRNLLDSMVLITDKFWGTSGVESVIGSVHTWLAEAINALQDNRDTLTAKVIQGCGNPKVNPQGPGPEEKRRRGKLAPRERPPSGTLEKLVSEAKAQLRDVQDFWISLPGTLCSEKMALSTASDDRCWNGMARGRYLPEVMGDGLANQINNPEVEVDITKPDMTIRQQIMQLKIMTNRLRSAYNGNDVDFQDASDDGSGSGSGDGCLDDLCSRKVSRKSSSSRTPLTHALPGLSEQEGQKTSAASCPQPPTFLLPLLLFLALTVARPRWR
Alternative Products
Event=Alternative splicing; Named isoforms=2; Name=1; IsoId=P35052-1; Sequence=Displayed; Name=2; IsoId=P35052-2; Sequence=VSP_055225, VSP_055226, VSP_055227
Alternative Sequence
1..72; Missing (in isoform 2); 295..359; DSMVLITDKFWGTSGVESVIGSVHTWLAEAINALQDNRDTLTAKVIQGCGNPKVNPQGPGPEEKR -> GEPPPARAAWNCLGECTTGGPGGRVVPSLELGPRDLIRDALTRARSGWCCRVEGPGCLLNVLSDV (in isoform 2); 360..558; Missing (in isoform 2)
3D Structural Models
Turn
41..43; 201..204
Helix
33..40; 46..48; 56..58; 71..130; 132..135; 138..153; 159..178; 187..192; 205..237; 244..254; 256..259; 269..279; 281..284; 287..300; 301..304; 313..315; 317..329; 332..335; 340..343; 374..388; 392..403; 434..436; 451..472
Beta Strand
60..62; 64..68; 180..182; 307..310; 418..422; 431..433; 440..442
3D Structure
X-ray crystallography (4)
Domain & Motif Annotations
Compositional Bias
355..370; Basic and acidic residues
Region
341..374; Disordered; 505..534; Disordered
Protein Families
Glypican family
Sequence Similarities
Belongs to the glypican family.
Clinical Relevance3
Interaction Protein (2)
ENSG00000113070ENSG00000164076
Interaction Count
2
Interaction Dataset
biogrid_bioplex
Supporting Publications4
| PMID | Title | Abstract |
|---|---|---|
| 36963204 | The mechanisms underlying the enrichment and action of glypican-1-positive exosomes in colorectal cancer cells. | No abstract available |
| 37288703 | Dual Tumor Exosome Biomarker Co-recognitions Based Nanoliquid Biopsy for the Accurate Early Diagnosis of Pancreatic Cancer. | This approach exhibits excellent specificity and ultrahigh sensitivity of detecting as low as 78 pg/mL pancreatic cancer exosome specific protein GPC1. |
| 37368911 | Quantification of GPC1(+) Exosomes Based on MALDI-TOF MS In Situ Signal Amplification for Pancreatic Cancer Discrimination and Evaluation. | No abstract available |
| 38204202 | Extracellular Vesicular Analysis of Glypican 1 mRNA and Protein for Pancreatic Cancer Diagnosis and Prognosis. | Utilizing an immune lipoplex nanoparticle (ILN) biochip assay, these findings demonstrate that glypican 1 (GPC1) mRNA expression in the exosomes-rich (Exo) EV subpopulation and GPC1 membrane protein (mProtein) expression in the microvesicles-rich (MV) EV subpopulation, particularly the tumor associated microvesicles (tMV), served as a viable biomarker for PDAC. |