Protein detail

GLRX1

Glutaredoxin-1 (Thioltransferase-1) (TTase-1)

Entry name GLRX1	UniProt ID P35754	EVMP confidence score 0.38
Supporting publications (n) 1	Transmembrane count	Protein classification Metabolic proteinsPlasma proteinsPredicted intracellular proteins

EVMP confidence score

Annotation confidence score; open for threshold definitions.

Extremely high >= 0.85High >= 0.70Medium >= 0.55Low >= 0.40

Basic Information11

Protein Names

Glutaredoxin-1 (Thioltransferase-1) (TTase-1)

Protein Class (3)

Metabolic proteinsPlasma proteinsPredicted intracellular proteins

Protein Function

Predicted intracellular proteins

Ensembl

ENSG00000173221

Entrez Gene Symbol

GLRX

Gene Synonym (2)

GRXGRX1

Gene Description

Glutaredoxin

Chromosome

Position

95751319-95822726

Supporting publications (n)

EVMP confidence score

0.38

Fluorescence & Localization1

Cell SpecificEnterocytes

Function & Pathway7

Protein Function

Predicted intracellular proteins

Cellular Component (3)

Molecular Function (3)

Biological Process (3)

Reactome (2)

Canonical Pathways (3)

M184 Pid ecadherin keratinocyte pathway
M266 Pid ncadherin pathway
M156 Pid ecadherin nascent aj pathway

Mediation Categories (2)

Fusion and delivery mediationMetabolism mediation

Relations & Evidence32

Ligand-Receptor Signaling (4)

4 records.

Category	Parent	Database	Transmitter	Receiver	Secreted	Plasma Membrane (Transmembrane)	Plasma Membrane (Peripheral)
intracellular	intracellular	ComPPI	No	No	No	No	No
intracellular	intracellular	GO_Intercell	No	No	No	No	No
intracellular	intracellular	UniProt_location	No	No	No	No	No
intracellular	intracellular	OmniPath	No	No	No	No	No

Protein Complex Composition (27)

27 records.

Component Name	Component Gene Symbols	Component UniProt ID	Stoichiometry	Database	Database IDs	References
BOLA2-GLRX3 complex	BOLA2 GLRX3	O76003 Q9H3K6	1:2	CORUMComplexPortal	CORUM:6958	22309771 14755292 27519415 32910989
KEOPS	GLRX3 OSGEP TP53RK TPRKB	O76003 Q96S44 Q9NPF4 Q9Y3C4	1:1:1:1	Compleat	Compleat:HC1364	16564010
Mitochondrial BOLA1-GLRX5 iron-sulfur cluster assembly complex	BOLA1 GLRX5	Q86SX6 Q9Y3E2	1:1	ComplexPortal	intact:EBI-27037395	27532772 14755292 32910989 22746225
Mitochondrial BOLA3-GLRX5 iron-sulfur cluster assembly complex	BOLA3 GLRX5	Q53S33 Q86SX6	1:1	ComplexPortal		27532772 14755292 32910989 22746225
	GLRX5 PGP PHPT1	A6NDG6 Q86SX6 Q9NRX4	0:0:0	hu.MAP
	ATOX1 ATP7A ATP7B CP GLRX UBC	O00244 P00450 P0CG48 P35670 P35754 Q04656	1:1:1:1:1:1	NetworkBlastCompleat	Compleat:HC4125
	ATOX1 ATP7A ATP7B GLRX SLC25A24 UBC	O00244 P0CG48 P35670 P35754 Q04656 Q6NUK1	1:1:1:1:1:1	NetworkBlastCompleat	Compleat:HC3775
	BOLA1 GLRX3 HGS HSPG2 STAM STAM2	O14964 O75886 O76003 P98160 Q92783 Q9Y3E2	0:0:0:0:0:0	hu.MAP2
	FABP3 FABP7 GLRX GOT2	O15540 P00505 P05413 P35754	0:0:0:0	hu.MAP
	BAG2 BAG3 DNAJC3 GLRX5 HSPA1B HSPA8 PMPCA PPP1R15A TRAP1 TSN	O75807 O95816 O95817 P0DMV9 P11142 Q10713 Q12931 Q13217 Q15631 Q86SX6	1:1:1:2:1:1:1:1:1:1	NetworkBlastCompleat	Compleat:HC8577

Page 1 of 3Next

Isolation & Detection Technology (1)

1 record.

EV Isolation Method	Detection Method	Number of References	References
Protein Organic Solvent Precipitation	Mass spectrometry	1	32384937

Sequence, Structure & Domains10

Sequences

Length

106

Mass

11,776

Sequence

MAQEFVNCKIQPGKVVVFIKPTCPYCRRAQEILSQLPIKQGLLEFVDITATNHTNEIQDYLQQLTGARTVPRVFIGKDCIGGCSDLVSLQQSGELLTRLKQIGALQ

3D Structural Models

Turn

48..51

Helix

2..9; 24..34; 54..65; 83..92; 94..101

Beta Strand

15..19; 42..47; 72..75; 78..82

3D Structure

NMR spectroscopy (2); X-ray crystallography (1)

Domain & Motif Annotations

Domain (FT)

3..106; Glutaredoxin

Protein Families

Glutaredoxin family

Sequence Similarities

Belongs to the glutaredoxin family.

Clinical Relevance2

Drugs (2)

BELATACEPT ABATACEPT

Antibody (3)

CAB008634 HPA046431 CAB069419

Supporting Publications1

PMID	Title	Abstract
32384937	Alzheimer's disease progression characterized by alterations in the molecular profiles and biogenesis of brain extracellular vesicles.	No abstract available