Protein detail
MOT8
Monocarboxylate transporter 8 (MCT 8) (Monocarboxylate transporter 7) (MCT 7) (Solute carrier family 16 member 2) (X-linked PEST-containing transporter)
Entry name MOT8 | UniProt ID | EVMP confidence score 0.40 |
Supporting publications (n) 4 | Transmembrane count 12 | Protein classification |
Annotation confidence score; open for threshold definitions.
Extremely high >= 0.70High >= 0.60Medium >= 0.40Low >= 0.30Basic Information
Protein Names
Monocarboxylate transporter 8 (MCT 8) (Monocarboxylate transporter 7) (MCT 7) (Solute carrier family 16 member 2) (X-linked PEST-containing transporter)
Protein Function (4)
- Transporters:Electrochemical Potential-driven transporters
- Disease related genes
- Potential drug targets
- Human disease related genes:Endocrine and metabolic diseases:Thyroid gland diseases
Transmembrane
97..117; Helical; Name=1; 144..164; Helical; Name=2; 172..192; Helical; Name=3; 201..221; Helical; Name=4; 230..250; Helical; Name=5; 259..279; Helical; Name=6; 323..343; Helical; Name=7; 357..377; Helical; Name=8; 387..407; Helical; Name=9; 410..430; Helical; Name=10; 448..468; Helical; Name=11; 478..498; Helical; Name=12
Transmembrane Count
12
Ensembl
Entrez Gene Symbol
Supporting publications (n)
4
EVMP confidence score
0.40
Function & Pathway
Protein Function (4)
- Transporters:Electrochemical Potential-driven transporters
- Disease related genes
- Potential drug targets
- Human disease related genes:Endocrine and metabolic diseases:Thyroid gland diseases
Cellular Component (2)
Molecular Function (4)
Biological Process (3)
Reactome (4)
Mediation Categories
Fusion and delivery mediation
Relations & Evidence18
Ligand-Receptor Signaling (15)
15 records.
| Category | Parent | Database | Transmitter | Receiver | Secreted | Plasma Membrane (Transmembrane) | Plasma Membrane (Peripheral) |
|---|---|---|---|---|---|---|---|
| plasma_membrane | plasma_membrane | UniProt_location | |||||
| plasma_membrane | plasma_membrane | Cellinker | |||||
| apical_cell_membrane | plasma_membrane | UniProt_location | |||||
| plasma_membrane | plasma_membrane | OmniPath | |||||
| transmembrane | transmembrane_predicted | Phobius |
Page 2 of 2Previous
Protein Complex Composition (2)
Sequence, Structure & Domains
Sequences
Length
539
Mass
59,511
Sequence
MALQSQASEEAKGPWQEADQEQQEPVGSPEPESEPEPEPEPEPVPVPPPEPQPEPQPLPDPAPLPELEFESERVHEPEPTPTVETRGTARGFQPPEGGFGWVVVFAATWCNGSIFGIHNSVGILYSMLLEEEKEKNRQVEFQAAWVGALAMGMIFFCSPIVSIFTDRLGCRITATAGAAVAFIGLHTSSFTSSLSLRYFTYGILFGCGCSFAFQPSLVILGHYFQRRLGLANGVVSAGSSIFSMSFPFLIRMLGDKIKLAQTFQVLSTFMFVLMLLSLTYRPLLPSSQDTPSKRGVRTLHQRFLAQLRKYFNMRVFRQRTYRIWAFGIAAAALGYFVPYVHLMKYVEEEFSEIKETWVLLVCIGATSGLGRLVSGHISDSIPGLKKIYLQVLSFLLLGLMSMMIPLCRDFGGLIVVCLFLGLCDGFFITIMAPIAFELVGPMQASQAIGYLLGMMALPMIAGPPIAGLLRNCFGDYHVAFYFAGVPPIIGAVILFFVPLMHQRMFKKEQRDSSKDKMLAPDPDPNGELLPGSPNPEEPI
3D Structural Models
3D Structure
Electron microscopy (6)
Domain & Motif Annotations
Compositional Bias
31..41; Acidic residues; 42..64; Pro residues; 508..518; Basic and acidic residues
Region
1..92; Disordered; 508..539; Disordered
Protein Families (2)
- Major facilitator superfamily
- Monocarboxylate porter (TC 2.A.1.13) family
Sequence Similarities
Belongs to the major facilitator superfamily. Monocarboxylate porter (TC 2.A.1.13) family.
Clinical Relevance
Interaction Protein
ENSG00000167930
Interaction Count
1
Interaction Dataset
intact_biogrid_opencell
Supporting Publications4
| PMID | Title | Related sentences |
|---|---|---|
| 26196085 | Identification of prostate cancer biomarkers in urinary exosomes. | No related sentences available |
| 28054239 | The Protein Content of Extracellular Vesicles Derived from Expanded Human Umbilical Cord Blood-Derived CD133+ and Human Bone Marrow-Derived Mesenchymal Stem Cells Partially Explains Why both Sources are Advantageous for Regenerative Medicine. | No related sentences available |
| 37686366 | Identification of a Non-Invasive Urinary Exosomal Biomarker for Diabetic Nephropathy Using Data-Independent Acquisition Proteomics. | No related sentences available |
| 38731868 | The Deep Proteomics Approach Identified Extracellular Vesicular Proteins Correlated to Extracellular Matrix in Type One and Two Endometrial Cancer. | No related sentences available |