Protein detail
TPOR
Thrombopoietin receptor (TPO-R) (Myeloproliferative leukemia protein) (Proto-oncogene c-Mpl) (CD antigen CD110)
Entry name TPOR | UniProt ID | EVMP confidence score 0.40 |
Supporting publications (n) 5 | Transmembrane count 1 | Protein classification |
Annotation confidence score; open for threshold definitions.
Extremely high >= 0.70High >= 0.60Medium >= 0.40Low >= 0.30Basic Information
Protein Names
Thrombopoietin receptor (TPO-R) (Myeloproliferative leukemia protein) (Proto-oncogene c-Mpl) (CD antigen CD110)
Protein Function (8)
- Human disease related genes:Cardiovascular diseases:Hematologic diseases
- Predicted intracellular proteins
- CD markers
- Human disease related genes:Cancers:Cancers of haematopoietic and lymphoid tissues
- Cancer-related genes
- Disease related genes
- FDA approved drug targets:Small molecule drugs
- FDA approved drug targets:Biotech drugs
Transmembrane
492..513; Helical
Transmembrane Count
1
Ensembl
Entrez Gene Symbol
Supporting publications (n)
5
EVMP confidence score
0.40
Function & Pathway
Protein Function (8)
- Human disease related genes:Cardiovascular diseases:Hematologic diseases
- Predicted intracellular proteins
- CD markers
- Human disease related genes:Cancers:Cancers of haematopoietic and lymphoid tissues
- Cancer-related genes
- Disease related genes
- FDA approved drug targets:Small molecule drugs
- FDA approved drug targets:Biotech drugs
Cellular Component (6)
Molecular Function (2)
Biological Process (3)
KEGG (3)
Reactome (3)
Mediation Categories (4)
Clinical-translation mediationFusion and delivery mediationImmune mediationReceptor-signaling mediation
Relations & Evidence72
Ligand-Receptor Signaling (65)
65 records.
| Category | Parent | Database | Transmitter | Receiver | Secreted | Plasma Membrane (Transmembrane) | Plasma Membrane (Peripheral) |
|---|---|---|---|---|---|---|---|
| receptor | receptor | SignaLink_function | Yes | Yes | |||
| cytokine | receptor | Almen2009 | Yes | Yes | |||
| ig_like | receptor | Almen2009 | Yes | Yes | |||
| type1_ig_like_cytokine | receptor | Almen2009 | Yes | Yes | |||
| cytokine_receptor | receptor | CellPhoneDB | Yes | Yes | |||
| ig | receptor | Surfaceome | Yes | Yes | |||
| type1 | receptor | Surfaceome | Yes | Yes | |||
| cytokiner | receptor | Surfaceome | Yes | Yes | |||
| cytokine | receptor | ICELLNET | Yes | Yes | |||
| cytokine_type_1 | receptor | ICELLNET | Yes | Yes |
Regulatory Interaction Network (4)
4 records.
| Source Protein Symbol | Source UniProt ID | Target Protein Symbol | Target UniProt ID | Is Directed | Is Stimulation | Is Inhibition | Database | References |
|---|---|---|---|---|---|---|---|---|
| TPOR | P40238 | JAK2 | O60674 | Yes | Yes | KEGG-MEDICUSHPRDSignaLink3WangLit-BM-17 | Lit-BM-17:24931576HPRD:10918061HPRD:10224114HPRD:7534285SignaLink3:23331499HPRD:10979953SignaLink3:7543416 | |
| TPO | P40225 | TPOR | P40238 | Yes | Yes | iTALKKirouac2010KEGG-MEDICUSGuide2Pharma_LRdbICELLNETSIGNORHINTSignaLink3DIPHPMR_talklrCellChatDBHPRD_LRdbDLRP_CellinkertalklrscConnectHPRDDLRP_talklrGuide2Pharma_CellinkerWangRamilowski2015HPMR_LRdbCellPhoneDBGuide2Pharma_talklrHPRD_talklrCellinkerSTRING_talklrCellCallGuide2PharmaCellTalkDBFantom5_LRdbHPMR_CellinkerconnectomeDB2020LRdb | SignaLink3:9766811LRdb:10495959Cellinker:10495959LRdb:98connectomeDB2020:9766811Cellinker:8521814HINT:37633268connectomeDB2020:10495959Cellinker:9766811SignaLink3:23331499HPRD:9766811ICELLNET:11784712DIP:9252374SignaLink3:7543416SIGNOR:11784712CellTalkDB:10495959 | |
| TPOR | P40238 | TYK2 | P29597 | Yes | Yes | WangSignaLink3 | SignaLink3:7543416SignaLink3:23331499 | |
| ATX2L | Q8WWM7 | TPOR | P40238 | Yes | Yes | HPRDSPIKE_LCLit-BM-17SIGNOR | Lit-BM-17:11784712SIGNOR:11784712SPIKE_LC:16713569HPRD:11784712 |
Protein Complex Composition (2)
Isolation & Detection Technology (1)
1 record.
| EV Isolation Method | Detection Method | Number of References | References |
|---|---|---|---|
| Protein Organic Solvent Precipitation | Mass spectrometry | 1 | 32384937 |
Sequence, Structure & Domains
Sequences
Length
635
Mass
71,245
Sequence
MPSWALFMVTSCLLLAPQNLAQVSSQDVSLLASDSEPLKCFSRTFEDLTCFWDEEEAAPSGTYQLLYAYPREKPRACPLSSQSMPHFGTRYVCQFPDQEEVRLFFPLHLWVKNVFLNQTRTQRVLFVDSVGLPAPPSIIKAMGGSQPGELQISWEEPAPEISDFLRYELRYGPRDPKNSTGPTVIQLIATETCCPALQRPHSASALDQSPCAQPTMPWQDGPKQTSPSREASALTAEGGSCLISGLQPGNSYWLQLRSEPDGISLGGSWGSWSLPVTVDLPGDAVALGLQCFTLDLKNVTCQWQQQDHASSQGFFYHSRARCCPRDRYPIWENCEEEEKTNPGLQTPQFSRCHFKSRNDSIIHILVEVTTAPGTVHSYLGSPFWIHQAVRLPTPNLHWREISSGHLELEWQHPSSWAAQETCYQLRYTGEGHQDWKVLEPPLGARGGTLELRPRSRYRLQLRARLNGPTYQGPWSSWSDPTRVETATETAWISLVTALHLVLGLSAVLGLLLLRWQFPAHYRRLRHALWPSLPDLHRVLGQYLRDTAALSPPKATVSDTCEEVEPSLLEILPKSSERTPLPLCSSQAQMDYRRLQPSCLGTMPLSVCPPMAESGSCCTTHIANHSYLPLSYWQQP
Alternative Products
Event=Alternative splicing; Named isoforms=2; Name=1; Synonyms=C-mpl-P; IsoId=P40238-1; Sequence=Displayed; Name=2; Synonyms=C-mpl-K; IsoId=P40238-2; Sequence=VSP_001734, VSP_001735
Alternative Sequence
523..579; RLRHALWPSLPDLHRVLGQYLRDTAALSPPKATVSDTCEEVEPSLLEILPKSSERTP -> YRPRQAGDWRWTRWSRTCKQAFLVRSVTPDLRPPPVRTYGFALPARHLWDSPRLLTL (in isoform 2); 580..635; Missing (in isoform 2)
3D Structural Models
Turn
114..116; 262..264; 295..297
Helix
28..30; 127..129; 159..161; 190..192; 284..287; 385..387
Beta Strand
37..41; 43..46; 49..56; 63..68; 70..72; 75..77; 79..83; 85..87; 89..93; 106..113; 119..126; 139..143; 149..155; 164..173; 183..187; 238..244; 248..260; 276..279; 292..294; 298..304; 309..320; 349..354; 359..371; 374..379; 396..400; 406..410; 421..428; 436..438; 446..449; 458..466; 468..474
3D Structure
Electron microscopy (1)
Domain & Motif Annotations
Motif
474..478; WSXWS motif; 528..536; Box 1 motif
Domain (CC)
The WSXWS motif appears to be necessary for proper protein folding and thereby efficient intracellular transport and cell-surface receptor binding.; DOMAIN: The box 1 motif is required for JAK interaction and/or activation.
Domain (FT)
172..281; Fibronectin type-III 1; 392..486; Fibronectin type-III 2
Region
205..232; Disordered
Protein Families (2)
- Type I cytokine receptor family
- Type 1 subfamily
Sequence Similarities
Belongs to the type I cytokine receptor family. Type 1 subfamily.
Clinical Relevance
Related Diseases (8)
Biomarker
Investigative; Phase 1; Phase 3; Phase 2; Approved; Terminated
Supporting Publications5
| PMID | Title | Related sentences |
|---|---|---|
| 32854315 | Proteomic Profiling of Extracellular Vesicles Derived from Cerebrospinal Fluid of Alzheimer's Disease Patients: A Pilot Study. | Recent studies have highlighted the importance of Aβ and tau-containing extracellular vesicles (EVs) in AD. |
| 37322475 | Comprehensive profiling of extracellular vesicles in uveitis and scleritis enables biomarker discovery and mechanism exploration. | No related sentences available |
| 38113368 | In-Depth Proteome Profiling of Small Extracellular Vesicles Isolated from Cancer Cell Lines and Patient Serum. | No related sentences available |
| 38207106 | Proteomic, Metabolomic, and Fatty Acid Profiling of Small Extracellular Vesicles from Glioblastoma Stem-Like Cells and Their Role in Tumor Heterogeneity. | No related sentences available |
| 40189497 | Small extracellular vesicle-based one-step high-throughput microfluidic platform for epithelial ovarian cancer diagnosis. | No related sentences available |