Protein detail

I12R1

Interleukin-12 receptor subunit beta-1 (IL-12 receptor subunit beta-1) (IL-12R subunit beta-1) (IL-12R-beta-1) (IL-12RB1) (IL-12 receptor beta component) (CD antigen CD212)

Entry name I12R1	UniProt ID P42701	EVMP confidence score 0.63
Supporting publications (n) 6	Transmembrane count 1	Protein classification

EVMP confidence score

Annotation confidence score; open for threshold definitions.

Extremely high >= 0.85High >= 0.70Medium >= 0.55Low >= 0.40

Basic Information8

Protein Names

Interleukin-12 receptor subunit beta-1 (IL-12 receptor subunit beta-1) (IL-12R subunit beta-1) (IL-12R-beta-1) (IL-12RB1) (IL-12 receptor beta component) (CD antigen CD212)

Protein Function (4)

Human disease related genes:Immune system diseases:Primary immunodeficiency
Disease related genes
CD markers
Predicted intracellular proteins

Transmembrane

546..570; Helical

Transmembrane Count

Ensembl

ENSG00000096996

Entrez Gene Symbol

IL12RB1

Supporting publications (n)

EVMP confidence score

0.63

Fluorescence & Localization4

Tissue Specificbone marrowCell SpecificEarly spermatidsBlood Cell SpecificbasophilBlood Lineage Specificgranulocytes

Function & Pathway7

Protein Function (4)

Human disease related genes:Immune system diseases:Primary immunodeficiency
Disease related genes
CD markers
Predicted intracellular proteins

Cellular Component (5)

Molecular Function (7)

Biological Process (3)

KEGG (6)

Reactome (5)

Mediation Categories (3)

Adhesion and uptake mediationFusion and delivery mediationImmune mediation

Relations & Evidence70

Ligand-Receptor Signaling (60)

60 records.

Category	Parent	Database	Transmitter	Receiver	Secreted	Plasma Membrane (Transmembrane)	Plasma Membrane (Peripheral)
receptor	receptor	CellPhoneDB	No	Yes	No	Yes	No
receptor	receptor	GO_Intercell	No	Yes	No	Yes	No
receptor	receptor	HPMR	No	Yes	No	Yes	No
receptor	receptor	ICELLNET	No	Yes	No	Yes	No
receptor	receptor	CellTalkDB	No	Yes	No	Yes	No
receptor	receptor	Surfaceome	No	Yes	No	Yes	No
receptor	receptor	Ramilowski2015	No	Yes	No	Yes	No
receptor	receptor	Kirouac2010	No	Yes	No	Yes	No
receptor	receptor	Guide2Pharma	No	Yes	No	Yes	No
receptor	receptor	LRdb	No	Yes	No	Yes	No

Page 1 of 6Next

Regulatory Interaction Network (5)

5 records.

Source Protein Symbol	Source UniProt ID	Target Protein Symbol	Target UniProt ID	Is Directed	Is Stimulation	Is Inhibition	Database	References
I12R1	P42701	JAK2	O60674	Yes	Yes	No	WangSignaLink3	SignaLink3:23331499 SignaLink3:10198225
IL12A	P29459	I12R1	P42701	Yes	Yes	No	iTALKSIGNORSignaLink3InnateDBDIPUniProt_LRdbLit-BM-17HPMR_talklrHPMRDLRP_CellinkertalklrRamilowski2015_Baccin2019DLRP_talklrWangRamilowski2015HPMR_LRdbBaccin2019CellinkerSTRING_talklrCellCallGuide2PharmaCellTalkDBFantom5_LRdbHPMR_CellinkerconnectomeDB2020LRdb	connectomeDB2020:11086056 Cellinker:11086056 LRdb:11086056 DIP:8943050 HPMR:11086056 InnateDB:7911493 Lit-BM-17:8943050 Baccin2019:11086056 SIGNOR:12023369 InnateDB:8943050 SignaLink3:23331499 Lit-BM-17:11114383 SignaLink3:7527811 CellTalkDB:11086056
IL23A	Q9NPF7	I12R1	P42701	Yes	Yes	No	iTALKSIGNORSignaLink3UniProt_LRdbHPMR_talklrHPMRHPRD_LRdbtalklrHPRDRamilowski2015_Baccin2019WangRamilowski2015HPMR_LRdbHPRD_talklrBaccin2019STRING_talklrEMBRACECellCallGuide2PharmaFantom5_LRdbCellTalkDBconnectomeDB2020LRdb	SIGNOR:12671732 connectomeDB2020:12671732 connectomeDB2020:12023369 SignaLink3:12023369 SignaLink3:12671732 Baccin2019:12671732 Baccin2019:11114383 Baccin2019:12023369 SignaLink3:18988627 LRdb:12023369 HPRD:11114383 SIGNOR:12023369 HPRD:12023369 SignaLink3:23331499 CellTalkDB:12023369 SignaLink3:11114383 connectomeDB2020:11114383 HPMR:12023369 LRdb:11114383 HPRD:12671732 LRdb:12671732
SOCS3	O14543	I12R1	P42701	Yes	Yes	Yes	WangSignaLink3	SignaLink3:23331499 SignaLink3:18708154
IL12B	P29460	I12R1	P42701	Yes	Yes	No	iTALKSIGNORHINTInnateDBUniProt_LRdbHPMRHPRD_LRdbtalklrscConnectHPRDRamilowski2015_Baccin2019DLRP_talklrWangRamilowski2015HPRD_talklrBaccin2019STRING_talklrCellCallGuide2PharmaCellTalkDBFantom5_LRdbconnectomeDB2020LRdb	HPRD:7527811 HINT:33606986LRdb:753Baccin2019:7527811 InnateDB:7911493 HPMR:11086056 LRdb:7843232 HINT:38287195 HPRD:7843232 connectomeDB2020:7527811 connectomeDB2020:7843232 InnateDB:8943050 Baccin2019:7843232 SIGNOR:7527811 CellTalkDB:7843232

Protein Complex Composition (4)

4 records.

Component Name	Component Gene Symbols	Component UniProt ID	Stoichiometry	Database	Database IDs	References
IL12A-IL12B-IL12RB1 complex	IL12A IL12B IL12RB1	P29459 P29460 P42701	1:1:1	CompleatCORUM	CORUM:2019Compleat:HC2658	9498755
IL23_receptor	IL12RB1 IL23R	P42701 Q5VWK5	1:1	Guide2PharmaCellChatDBKEGG-MEDICUSCellPhoneDBICELLNETCompleatCellinker	CellPhoneDB:IL23_receptorCompleat:HC1647	12023369
Interleukin-23 receptor-ligand complex	IL12B IL12RB1 IL23A IL23R	P29460 P42701 Q5VWK5 Q9NPF7	1:1:1:1	ComplexPortalPDB	PDB:3QWRPDB:3DUHPDB:5MJ4PDB:6wdqintact:EBI-59033272PDB:8OE4PDB:3D87	7722452 7638186 19088061 11114383 16482511 14755292 25516297 12023369
	IL12RB1	P42701	2	PDB	PDB:8c7m

Isolation & Detection Technology (1)

1 record.

EV Isolation Method	Detection Method	Number of References	References
Differential Ultracentrifugation	Western BlottingMass SpectrometryFlow Cytometry	2	38207106 37926756

Sequence, Structure & Domains16

Sequences

Length

662

Mass

73,109

Sequence

MEPLVTWVVPLLFLFLLSRQGAACRTSECCFQDPPYPDADSGSASGPRDLRCYRISSDRYECSWQYEGPTAGVSHFLRCCLSSGRCCYFAAGSATRLQFSDQAGVSVLYTVTLWVESWARNQTEKSPEVTLQLYNSVKYEPPLGDIKVSKLAGQLRMEWETPDNQVGAEVQFRHRTPSSPWKLGDCGPQDDDTESCLCPLEMNVAQEFQLRRRQLGSQGSSWSKWSSPVCVPPENPPQPQVRFSVEQLGQDGRRRLTLKEQPTQLELPEGCQGLAPGTEVTYRLQLHMLSCPCKAKATRTLHLGKMPYLSGAAYNVAVISSNQFGPGLNQTWHIPADTHTEPVALNISVGTNGTTMYWPARAQSMTYCIEWQPVGQDGGLATCSLTAPQDPDPAGMATYSWSRESGAMGQEKCYYITIFASAHPEKLTLWSTVLSTYHFGGNASAAGTPHHVSVKNHSLDSVSVDWAPSLLSTCPGVLKEYVVRCRDEDSKQVSEHPVQPTETQVTLSGLRAGVAYTVQVRADTAWLRGVWSQPQRFSIEVQVSDWLIFFASLGSFLSILLVGVLGYLGLNRAARHLCPPLPTPCASSAIEFPGGKETWQWINPVDFQEEASLQEALVVEMSWDKGERTEPLEKTELPEGAPELALDTELSLEDGDRCKAKM

Alternative Products

Event=Alternative splicing; Named isoforms=3; Name=1; Synonyms=Long; IsoId=P42701-1; Sequence=Displayed; Name=2; Synonyms=Short; IsoId=P42701-2; Sequence=VSP_001715; Name=3; IsoId=P42701-3; Sequence=VSP_037043, VSP_037044

Alternative Sequence

341..422; EPVALNISVGTNGTTMYWPARAQSMTYCIEWQPVGQDGGLATCSLTAPQDPDPAGMATYSWSRESGAMGQEKCYYITIFASA -> DGMISAHCNLRLPDSRDSPASASRVAGITGICHHTRLILYF (in isoform 3); 423..662; Missing (in isoform 3); 659..662; KAKM -> DR (in isoform 2)

3D Structural Models

Turn

406..408; 475..477; 488..490

Helix

133..135; 403..405; 427..429; 443..446; 470..473

Beta Strand

46..54; 56..68; 74..80; 86..92; 95..100; 107..119; 122..125; 129..132; 147..151; 154..160; 167..175; 177..179; 182..189; 191..199; 206..214; 216..218; 229..231; 241..245; 254..260; 282..288; 298..301; 314..320; 330..334; 348..350; 353..359; 362..373; 382..385; 395..402; 410..422; 431..439; 453..458; 461..465; 478..487; 493..498; 504..507; 515..526; 535..538

3D Structure

Electron microscopy (3); X-ray crystallography (4)

Domain & Motif Annotations

Compositional Bias

626..637; Basic and acidic residues

Motif

222..226; WSXWS motif; 577..585; Box 1 motif

Domain (CC)

The WSXWS motif appears to be necessary for proper protein folding and thereby efficient intracellular transport and cell-surface receptor binding.; DOMAIN: The box 1 motif is required for JAK interaction and/or activation.

Domain (FT)

46..136; Fibronectin type-III 1; 142..234; Fibronectin type-III 2; 237..337; Fibronectin type-III 3; 338..444; Fibronectin type-III 4; 448..542; Fibronectin type-III 5

Region

626..648; Disordered

Protein Families (2)

Type I cytokine receptor family
Type 2 subfamily

Sequence Similarities

Belongs to the type I cytokine receptor family. Type 2 subfamily.

Clinical Relevance1

Drugs (3)

DENILEUKIN DIFTITOX NULL AS1409

Supporting Publications6

PMID	Title	Abstract
24505114	Proteomics analysis of cancer exosomes using a novel modified aptamer-based array (SOMAscan™) platform.	These included proteins of known association with cancer exosomes such as MFG-E8, integrins, and MET, and also those less widely reported as exosomally associated, such as ROR1 and ITIH4.
25471207	Intraluminal proteome and peptidome of human urinary extracellular vesicles.	No abstract available
26801919	Exosomes Secreted by Apoptosis-Resistant Acute Myeloid Leukemia (AML) Blasts Harbor Regulatory Network Proteins Potentially Involved in Antagonism of Apoptosis.	No abstract available
31588238	Dual-platform affinity proteomics identifies links between the recurrence of ovarian carcinoma and proteins released into the tumor microenvironment.	No abstract available
38731868	The Deep Proteomics Approach Identified Extracellular Vesicular Proteins Correlated to Extracellular Matrix in Type One and Two Endometrial Cancer.	No abstract available
40098346	Toward Identification of Markers for Brain-Derived Extracellular Vesicles in Cerebrospinal Fluid: A Large-Scale, Unbiased Analysis Using Proximity Extension Assays.	No abstract available