Protein detail
I12R1
Interleukin-12 receptor subunit beta-1 (IL-12 receptor subunit beta-1) (IL-12R subunit beta-1) (IL-12R-beta-1) (IL-12RB1) (IL-12 receptor beta component) (CD antigen CD212)
Entry name I12R1 | UniProt ID | EVMP confidence score 0.63 |
Supporting publications (n) 6 | Transmembrane count 1 | Protein classification |
Annotation confidence score; open for threshold definitions.
Extremely high >= 0.70High >= 0.60Medium >= 0.40Low >= 0.30Basic Information
Protein Names
Interleukin-12 receptor subunit beta-1 (IL-12 receptor subunit beta-1) (IL-12R subunit beta-1) (IL-12R-beta-1) (IL-12RB1) (IL-12 receptor beta component) (CD antigen CD212)
Protein Function (4)
- Human disease related genes:Immune system diseases:Primary immunodeficiency
- Disease related genes
- CD markers
- Predicted intracellular proteins
Transmembrane
546..570; Helical
Transmembrane Count
1
Ensembl
Entrez Gene Symbol
Supporting publications (n)
6
EVMP confidence score
0.63
Fluorescence & Localization
Tissue Specificbone marrowCell SpecificEarly spermatidsBlood Cell SpecificbasophilBlood Lineage Specificgranulocytes
Function & Pathway
Protein Function (4)
- Human disease related genes:Immune system diseases:Primary immunodeficiency
- Disease related genes
- CD markers
- Predicted intracellular proteins
Cellular Component (5)
Molecular Function (7)
Biological Process (3)
KEGG (6)
Reactome (5)
Mediation Categories (3)
Adhesion and uptake mediationFusion and delivery mediationImmune mediation
Relations & Evidence70
Ligand-Receptor Signaling (60)
60 records.
| Category | Parent | Database | Transmitter | Receiver | Secreted | Plasma Membrane (Transmembrane) | Plasma Membrane (Peripheral) |
|---|---|---|---|---|---|---|---|
| receptor | receptor | Baccin2019 | Yes | Yes | |||
| receptor | receptor | SignaLink_function | Yes | Yes | |||
| cytokine_receptor | receptor | CellPhoneDB | Yes | Yes | |||
| interleukin | receptor | Baccin2019 | Yes | Yes | |||
| cytokine_type_1 | receptor | HPMR | Yes | Yes | |||
| prolactin | receptor | HPMR | Yes | Yes | |||
| ig | receptor | Surfaceome | Yes | Yes | |||
| type1 | receptor | Surfaceome | Yes | Yes | |||
| cytokiner | receptor | Surfaceome | Yes | Yes | |||
| cytokine | receptor | ICELLNET | Yes | Yes |
Regulatory Interaction Network (5)
5 records.
Protein Complex Composition (4)
4 records.
| Component Name | Component Gene Symbols | Component UniProt ID | Stoichiometry | Database | Database IDs | References |
|---|---|---|---|---|---|---|
| IL12A-IL12B-IL12RB1 complex | IL12AIL12BIL12RB1 | P29459P29460P42701 | 1:1:1 | CompleatCORUM | CORUM:2019Compleat:HC2658 | 9498755 |
| IL23_receptor | IL12RB1IL23R | P42701Q5VWK5 | 1:1 | Guide2PharmaCellChatDBKEGG-MEDICUSCellPhoneDBICELLNETCompleatCellinker | CellPhoneDB:IL23_receptorCompleat:HC1647 | 12023369 |
| Interleukin-23 receptor-ligand complex | IL12BIL12RB1IL23AIL23R | P29460P42701Q5VWK5Q9NPF7 | 1:1:1:1 | ComplexPortalPDB | PDB:3QWRPDB:3DUHPDB:5MJ4PDB:6wdqintact:EBI-59033272PDB:8OE4PDB:3D87 | 77224527638186190880611111438316482511147552922551629712023369 |
| IL12RB1 | P42701 | 2 | PDB | PDB:8c7m |
Sequence, Structure & Domains
Sequences
Length
662
Mass
73,109
Sequence
MEPLVTWVVPLLFLFLLSRQGAACRTSECCFQDPPYPDADSGSASGPRDLRCYRISSDRYECSWQYEGPTAGVSHFLRCCLSSGRCCYFAAGSATRLQFSDQAGVSVLYTVTLWVESWARNQTEKSPEVTLQLYNSVKYEPPLGDIKVSKLAGQLRMEWETPDNQVGAEVQFRHRTPSSPWKLGDCGPQDDDTESCLCPLEMNVAQEFQLRRRQLGSQGSSWSKWSSPVCVPPENPPQPQVRFSVEQLGQDGRRRLTLKEQPTQLELPEGCQGLAPGTEVTYRLQLHMLSCPCKAKATRTLHLGKMPYLSGAAYNVAVISSNQFGPGLNQTWHIPADTHTEPVALNISVGTNGTTMYWPARAQSMTYCIEWQPVGQDGGLATCSLTAPQDPDPAGMATYSWSRESGAMGQEKCYYITIFASAHPEKLTLWSTVLSTYHFGGNASAAGTPHHVSVKNHSLDSVSVDWAPSLLSTCPGVLKEYVVRCRDEDSKQVSEHPVQPTETQVTLSGLRAGVAYTVQVRADTAWLRGVWSQPQRFSIEVQVSDWLIFFASLGSFLSILLVGVLGYLGLNRAARHLCPPLPTPCASSAIEFPGGKETWQWINPVDFQEEASLQEALVVEMSWDKGERTEPLEKTELPEGAPELALDTELSLEDGDRCKAKM
Alternative Products
Event=Alternative splicing; Named isoforms=3; Name=1; Synonyms=Long; IsoId=P42701-1; Sequence=Displayed; Name=2; Synonyms=Short; IsoId=P42701-2; Sequence=VSP_001715; Name=3; IsoId=P42701-3; Sequence=VSP_037043, VSP_037044
Alternative Sequence
341..422; EPVALNISVGTNGTTMYWPARAQSMTYCIEWQPVGQDGGLATCSLTAPQDPDPAGMATYSWSRESGAMGQEKCYYITIFASA -> DGMISAHCNLRLPDSRDSPASASRVAGITGICHHTRLILYF (in isoform 3); 423..662; Missing (in isoform 3); 659..662; KAKM -> DR (in isoform 2)
3D Structural Models
Turn
406..408; 475..477; 488..490
Helix
133..135; 403..405; 427..429; 443..446; 470..473
Beta Strand
46..54; 56..68; 74..80; 86..92; 95..100; 107..119; 122..125; 129..132; 147..151; 154..160; 167..175; 177..179; 182..189; 191..199; 206..214; 216..218; 229..231; 241..245; 254..260; 282..288; 298..301; 314..320; 330..334; 348..350; 353..359; 362..373; 382..385; 395..402; 410..422; 431..439; 453..458; 461..465; 478..487; 493..498; 504..507; 515..526; 535..538
3D Structure
Electron microscopy (3); X-ray crystallography (4)
Domain & Motif Annotations
Compositional Bias
626..637; Basic and acidic residues
Motif
222..226; WSXWS motif; 577..585; Box 1 motif
Domain (CC)
The WSXWS motif appears to be necessary for proper protein folding and thereby efficient intracellular transport and cell-surface receptor binding.; DOMAIN: The box 1 motif is required for JAK interaction and/or activation.
Domain (FT)
46..136; Fibronectin type-III 1; 142..234; Fibronectin type-III 2; 237..337; Fibronectin type-III 3; 338..444; Fibronectin type-III 4; 448..542; Fibronectin type-III 5
Region
626..648; Disordered
Protein Families (2)
- Type I cytokine receptor family
- Type 2 subfamily
Sequence Similarities
Belongs to the type I cytokine receptor family. Type 2 subfamily.
Clinical Relevance
Drugs (3)
Supporting Publications6
| PMID | Title | Related sentences |
|---|---|---|
| 24505114 | Proteomics analysis of cancer exosomes using a novel modified aptamer-based array (SOMAscan™) platform. | These included proteins of known association with cancer exosomes such as MFG-E8, integrins, and MET, and also those less widely reported as exosomally associated, such as ROR1 and ITIH4. |
| 25471207 | Intraluminal proteome and peptidome of human urinary extracellular vesicles. | No related sentences available |
| 26801919 | Exosomes Secreted by Apoptosis-Resistant Acute Myeloid Leukemia (AML) Blasts Harbor Regulatory Network Proteins Potentially Involved in Antagonism of Apoptosis. | No related sentences available |
| 31588238 | Dual-platform affinity proteomics identifies links between the recurrence of ovarian carcinoma and proteins released into the tumor microenvironment. | No related sentences available |
| 38731868 | The Deep Proteomics Approach Identified Extracellular Vesicular Proteins Correlated to Extracellular Matrix in Type One and Two Endometrial Cancer. | No related sentences available |
| 40098346 | Toward Identification of Markers for Brain-Derived Extracellular Vesicles in Cerebrospinal Fluid: A Large-Scale, Unbiased Analysis Using Proximity Extension Assays. | No related sentences available |