Protein detail

LPAR6

Lysophosphatidic acid receptor 6 (LPA receptor 6) (LPA-6) (Oleoyl-L-alpha-lysophosphatidic acid receptor) (P2Y purinoceptor 5) (P2Y5) (Purinergic receptor 5) (RB intron encoded G-protein coupled receptor)

Protein symbol LPAR6	UniProt ID P43657	EVMP score 0.50
Frequency 2	Transmembrane count 7	Protein classification Disease related genesG-protein coupled receptorsHuman disease related genesPotential drug targetsPredicted membrane proteins

EVMP score: annotation confidence score.

Extremely high >= 0.85High >= 0.70Medium >= 0.55Low >= 0.40

Basic Information

Protein Names

Protein Class

Disease related genesG-protein coupled receptorsHuman disease related genesPotential drug targetsPredicted membrane proteins

Protein Function

G-protein coupled receptors:Lysolipids receptors
Potential drug targets
Human disease related genes:Skin diseases:Skin and soft tissue diseases
Human disease related genes:Congenital malformations:Congenital malformations of skin
G-protein coupled receptors:GPCRs excl olfactory receptors
Disease related genes

Transmembrane

20..46; Helical; Name=1; 56..79; Helical; Name=2; 93..112; Helical; Name=3; 134..154; Helical; Name=4; 182..209; Helical; Name=5; 228..253; Helical; Name=6; 273..292; Helical; Name=7

Transmembrane Count

Ensembl

ENSG00000139679

Entrez Gene Symbol

LPAR6

Gene Synonym

P2RY5P2Y5

Gene Description

Lysophosphatidic acid receptor 6

Chromosome

Position

48389567-48444704

Frequency

EVMP Score

0.50

Fluorescence & Localization

Cell SpecificAstrocytesSingle-Nuclei Brain Specificastrocyte

Function & Pathway

Protein Function

G-protein coupled receptors:Lysolipids receptors
Potential drug targets
Human disease related genes:Skin diseases:Skin and soft tissue diseases
Human disease related genes:Congenital malformations:Congenital malformations of skin
G-protein coupled receptors:GPCRs excl olfactory receptors
Disease related genes

Cellular Component

GO:0005886 plasma membrane

Molecular Function

Biological Process

KEGG

Reactome

Mediation Categories

Receptor-signaling mediation

Relations & Evidence

Enzyme-Mediated Modification

0 records.

Ligand-Receptor Signaling

38 records.

Category	Parent	Database	Transmitter	Receiver	Secreted	Plasma Membrane (Transmembrane)	Plasma Membrane (Peripheral)
transmembrane	transmembrane	UniProt_topology	No	No	No	Yes	No
transmembrane	transmembrane	UniProt_keyword	No	No	No	Yes	No
transmembrane	transmembrane	GO_Intercell	No	No	No	Yes	No
transmembrane	transmembrane	Ramilowski_location	No	No	No	Yes	No
transmembrane	transmembrane	OmniPath	No	No	No	Yes	No
plasma_membrane	plasma_membrane	UniProt_location	No	No	No	Yes	No
plasma_membrane	plasma_membrane	OmniPath	No	No	No	Yes	No
plasma_membrane_transmembrane	plasma_membrane_transmembrane	HPMR	No	No	No	Yes	No
plasma_membrane_transmembrane	plasma_membrane_transmembrane	OmniPath	No	No	No	Yes	No
cell_surface	cell_surface	Surfaceome	No	No	No	Yes	No

Page 3 of 4Previous Next

Regulatory Interaction Network

12 records.

Source Protein Symbol	Source UniProt ID	Target Protein Symbol	Target UniProt ID	Is Directed	Is Stimulation	Is Inhibition	Database	References
LPAR6	P43657	GNAO	P09471	Yes	Yes	No	SIGNOR	SIGNOR:31160049
LPAR6	P43657	GNA13	Q14344	Yes	Yes	No	SIGNOR	SIGNOR:31160049
LPAR6	P43657	GNAI1	P63096	Yes	Yes	No	SIGNOR	SIGNOR:31160049
LPAR6	P43657	GNAI3	P08754	Yes	Yes	No	SIGNOR	SIGNOR:31160049
LPAR6	P43657	GNAQ	P50148	Yes	Yes	No	SIGNOR	SIGNOR:15856019
LPAR6	P43657	GNA14	O95837	Yes	Yes	No	SIGNOR	SIGNOR:31160049
LPAR6	P43657	GNAZ	P19086	Yes	Yes	No	SIGNOR	SIGNOR:31160049
LPAR6	P43657	GNA12	Q03113	Yes	Yes	No	SIGNOR	SIGNOR:31160049
LPAR6	P43657	GNAS3	O95467	Yes	Yes	No	SIGNOR	SIGNOR:23182454
LPAR6	P43657	ALEX	P84996	Yes	Yes	No	SIGNOR	SIGNOR:23182454

Page 1 of 2Next

Protein Complex Composition

2 records.

Component Name	Component Gene Symbols	Component UniProt ID	Stoichiometry	Database	Database IDs	References
	ABHD17A BMP7 C5AR2 GSTCD LPAR6 PTPN1 TTK	P18031 P18075 P33981 P43657 Q8NEC7 Q96GS6 Q9P296	0:0:0:0:0:0:0	hu.MAP2
	ABHD17A ABHD17B CLMN DYNLT2B LPAR6	P43657 Q5VST6 Q8WW35 Q96GS6 Q96JQ2	0:0:0:0:0	hu.MAP2

Isolation & Detection Technology

1 record.

EV Isolation Method	Detection Method	Number of References	References
Differential UltracentrifugationSize Exclusion Chromatography	Mass spectrometry	2	36507906 39535266

Sequence, Structure & Domains

Sequences

Length

344

Mass

39,392

Sequence

MVSVNSSHCFYNDSFKYTLYGCMFSMVFVLGLISNCVAIYIFICVLKVRNETTTYMINLAMSDLLFVFTLPFRIFYFTTRNWPFGDLLCKISVMLFYTNMYGSILFLTCISVDRFLAIVYPFKSKTLRTKRNAKIVCTGVWLTVIGGSAPAVFVQSTHSQGNNASEACFENFPEATWKTYLSRIVIFIEIVGFFIPLILNVTCSSMVLKTLTKPVTLSRSKINKTKVLKMIFVHLIIFCFCFVPYNINLILYSLVRTQTFVNCSVVAAVRTMYPITLCIAVSNCCFDPIVYYFTSDTIQNSIKMKNWSVRRSDFRFSEVHGAENFIQHNLQTLKSKIFDNESAA

3D Structural Models

Turn

123..127

Helix

16..44; 51..67; 70..79; 86..119; 130..145; 149..152; 174..179; 181..192; 194..209; 228..257; 263..275; 278..282; 283..285; 287..290; 296..298

Beta Strand

168..171; 216..220; 225..227; 292..295

3D Structure

Electron microscopy (2)

Domain & Motif Annotations

Protein Families

G-protein coupled receptor 1 family

Sequence Similarities

Belongs to the G-protein coupled receptor 1 family.

Clinical Relevance

Disease Involvement

Disease variantHypotrichosis

Drugs

MC-1

Antibody

HPA028934 HPA076273