Protein detail

LPAR6

Lysophosphatidic acid receptor 6 (LPA receptor 6) (LPA-6) (Oleoyl-L-alpha-lysophosphatidic acid receptor) (P2Y purinoceptor 5) (P2Y5) (Purinergic receptor 5) (RB intron encoded G-protein coupled receptor)

Entry name LPAR6	UniProt ID P43657	EVMP confidence score 0.50
Supporting publications (n) 2	Transmembrane count 7	Protein classification Disease related genesG-protein coupled receptorsHuman disease related genesPotential drug targetsPredicted membrane proteins

EVMP confidence score

Annotation confidence score; open for threshold definitions.

Extremely high >= 0.85High >= 0.70Medium >= 0.55Low >= 0.40

Basic Information13

Protein Names

Protein Class (5)

Disease related genesG-protein coupled receptorsHuman disease related genesPotential drug targetsPredicted membrane proteins

Protein Function (6)

G-protein coupled receptors:Lysolipids receptors
Potential drug targets
Human disease related genes:Skin diseases:Skin and soft tissue diseases
Human disease related genes:Congenital malformations:Congenital malformations of skin
G-protein coupled receptors:GPCRs excl olfactory receptors
Disease related genes

Transmembrane

20..46; Helical; Name=1; 56..79; Helical; Name=2; 93..112; Helical; Name=3; 134..154; Helical; Name=4; 182..209; Helical; Name=5; 228..253; Helical; Name=6; 273..292; Helical; Name=7

Transmembrane Count

Ensembl

ENSG00000139679

Entrez Gene Symbol

LPAR6

Gene Synonym (2)

P2RY5P2Y5

Gene Description

Lysophosphatidic acid receptor 6

Chromosome

Position

48389567-48444704

Supporting publications (n)

EVMP confidence score

0.50

Fluorescence & Localization3

Cell SpecificAstrocytesSingle-Nuclei Brain Specificastrocyte

Function & Pathway7

Protein Function (6)

G-protein coupled receptors:Lysolipids receptors
Potential drug targets
Human disease related genes:Skin diseases:Skin and soft tissue diseases
Human disease related genes:Congenital malformations:Congenital malformations of skin
G-protein coupled receptors:GPCRs excl olfactory receptors
Disease related genes

Cellular Component

GO:0005886 plasma membrane

Molecular Function (2)

Biological Process (3)

KEGG (4)

Reactome (6)

Mediation Categories

Receptor-signaling mediation

Relations & Evidence53

Ligand-Receptor Signaling (38)

38 records.

Category	Parent	Database	Transmitter	Receiver	Secreted	Plasma Membrane (Transmembrane)	Plasma Membrane (Peripheral)
cell_surface	cell_surface	OmniPath	No	No	No	Yes	No
receptor	receptor	scConnect	No	Yes	No	Yes	No
receptor	receptor	Almen2009	No	Yes	No	Yes	No
receptor	receptor	CellCellInteractions	No	Yes	No	Yes	No
gpcr	receptor	GPCRdb	No	Yes	No	Yes	No
lysophosphatidic_acid	receptor	HGNC	No	Yes	No	Yes	No
receptor	receptor	HGNC	No	Yes	No	Yes	No
transmembrane	transmembrane_predicted	Phobius	No	No	No	Yes	No

Page 4 of 4Previous

Regulatory Interaction Network (12)

12 records.

Source Protein Symbol	Source UniProt ID	Target Protein Symbol	Target UniProt ID	Is Directed	Is Stimulation	Is Inhibition	Database	References
LPAR6	P43657	GNAO	P09471	Yes	Yes	No	SIGNOR	SIGNOR:31160049
LPAR6	P43657	GNA13	Q14344	Yes	Yes	No	SIGNOR	SIGNOR:31160049
LPAR6	P43657	GNAI1	P63096	Yes	Yes	No	SIGNOR	SIGNOR:31160049
LPAR6	P43657	GNAI3	P08754	Yes	Yes	No	SIGNOR	SIGNOR:31160049
LPAR6	P43657	GNAQ	P50148	Yes	Yes	No	SIGNOR	SIGNOR:15856019
LPAR6	P43657	GNA14	O95837	Yes	Yes	No	SIGNOR	SIGNOR:31160049
LPAR6	P43657	GNAZ	P19086	Yes	Yes	No	SIGNOR	SIGNOR:31160049
LPAR6	P43657	GNA12	Q03113	Yes	Yes	No	SIGNOR	SIGNOR:31160049
LPAR6	P43657	GNAS3	O95467	Yes	Yes	No	SIGNOR	SIGNOR:23182454
LPAR6	P43657	ALEX	P84996	Yes	Yes	No	SIGNOR	SIGNOR:23182454

Page 1 of 2Next

Protein Complex Composition (2)

2 records.

Component Name	Component Gene Symbols	Component UniProt ID	Stoichiometry	Database	Database IDs	References
	ABHD17A BMP7 C5AR2 GSTCD LPAR6 PTPN1 TTK	P18031 P18075 P33981 P43657 Q8NEC7 Q96GS6 Q9P296	0:0:0:0:0:0:0	hu.MAP2
	ABHD17A ABHD17B CLMN DYNLT2B LPAR6	P43657 Q5VST6 Q8WW35 Q96GS6 Q96JQ2	0:0:0:0:0	hu.MAP2

Isolation & Detection Technology (1)

1 record.

EV Isolation Method	Detection Method	Number of References	References
Differential UltracentrifugationSize Exclusion Chromatography	Mass spectrometry	2	36507906 39535266

Sequence, Structure & Domains9

Sequences

Length

344

Mass

39,392

Sequence

MVSVNSSHCFYNDSFKYTLYGCMFSMVFVLGLISNCVAIYIFICVLKVRNETTTYMINLAMSDLLFVFTLPFRIFYFTTRNWPFGDLLCKISVMLFYTNMYGSILFLTCISVDRFLAIVYPFKSKTLRTKRNAKIVCTGVWLTVIGGSAPAVFVQSTHSQGNNASEACFENFPEATWKTYLSRIVIFIEIVGFFIPLILNVTCSSMVLKTLTKPVTLSRSKINKTKVLKMIFVHLIIFCFCFVPYNINLILYSLVRTQTFVNCSVVAAVRTMYPITLCIAVSNCCFDPIVYYFTSDTIQNSIKMKNWSVRRSDFRFSEVHGAENFIQHNLQTLKSKIFDNESAA

3D Structural Models

Turn

123..127

Helix

16..44; 51..67; 70..79; 86..119; 130..145; 149..152; 174..179; 181..192; 194..209; 228..257; 263..275; 278..282; 283..285; 287..290; 296..298

Beta Strand

168..171; 216..220; 225..227; 292..295

3D Structure

Electron microscopy (2)

Domain & Motif Annotations

Protein Families

G-protein coupled receptor 1 family

Sequence Similarities

Belongs to the G-protein coupled receptor 1 family.

Clinical Relevance3

Disease Involvement (2)

Disease variantHypotrichosis

Drugs

MC-1

Antibody (2)

HPA028934 HPA076273

Supporting Publications2

PMID	Title	Abstract
34265469	Proteomic Landscape of Exosomes Reveals the Functional Contributions of CD151 in Triple-Negative Breast Cancer.	Furthermore, utilizing quantitative proteomics approach to reveal the proteomes of CD151-deleted exosomes and cells, we found that exosomal CD151 facilitated secretion of ribosomal proteins via exosomes while inhibiting exosome secretion of complement proteins. Moreover, we proved that CD151-deleted exosomes significantly decreased the migration and invasion of TNBC cells. Most importantly, we found that the tetraspanin CD151 expression levels in TNBC-derived serum exosomes were significantly higher than those exosomes from healthy subjects, and we validated our findings with samples from 16 additional donors. This is the first comparative study of the proteomes of TNBC patient-derived and CD151-deleted exosomes.
37403840	Phosphoproteome analysis of cerebrospinal fluid extracellular vesicles in primary central nervous system lymphoma.	No abstract available