Protein detail
HINT1
Adenosine 5'-monophosphoramidase HINT1 (EC 3.9.1.-) (Desumoylating isopeptidase HINT1) (EC 3.4.22.-) (Histidine triad nucleotide-binding protein 1) (Protein kinase C inhibitor 1) (Protein kinase C-interacting protein 1) (PKCI-1)
Entry name HINT1 | UniProt ID | EVMP confidence score 0.53 |
Supporting publications (n) 1 | Transmembrane count | Protein classification Disease related genesHuman disease related genesPlasma proteinsPredicted intracellular proteins |
Annotation confidence score; open for threshold definitions.
Extremely high >= 0.70High >= 0.60Medium >= 0.40Low >= 0.30Basic Information
Protein Names
Adenosine 5'-monophosphoramidase HINT1 (EC 3.9.1.-) (Desumoylating isopeptidase HINT1) (EC 3.4.22.-) (Histidine triad nucleotide-binding protein 1) (Protein kinase C inhibitor 1) (Protein kinase C-interacting protein 1) (PKCI-1)
Protein Class (4)
Disease related genesHuman disease related genesPlasma proteinsPredicted intracellular proteins
Protein Function (3)
- Disease related genes
- Human disease related genes:Nervous system diseases:Other nervous and sensory system diseases
- Predicted intracellular proteins
Ensembl
Entrez Gene Symbol
Gene Synonym (3)
HINTPKCI-1PRKCNH1
Gene Description
Histidine triad nucleotide binding protein 1
Chromosome
5
Position
131155383-131224468
Supporting publications (n)
1
EVMP confidence score
0.53
Fluorescence & Localization
Tissue Specificbone marrowCell SpecificcDCSingle-Nuclei Brain Specificleukocyte
Function & Pathway
Protein Function (3)
- Disease related genes
- Human disease related genes:Nervous system diseases:Other nervous and sensory system diseases
- Predicted intracellular proteins
Cellular Component (8)
Molecular Function (6)
Biological Process (3)
Reactome (5)
- R-hsa-9856651 mitf m dependent gene expression
- R-hsa-9730414 mitf m regulated melanocyte development
- R-hsa-9824594 regulation of mitf m dependent genes involved in apoptosis
- R-hsa-9825892 regulation of mitf m dependent genes involved in cell cycle and proliferation
- R-hsa-9856649 transcriptional and post translational regulation of mitf m expression and activity
Mediation Categories
Receptor-signaling mediation
Relations & Evidence21
Ligand-Receptor Signaling (5)
5 records.
| Category | Parent | Database | Transmitter | Receiver | Secreted | Plasma Membrane (Transmembrane) | Plasma Membrane (Peripheral) |
|---|---|---|---|---|---|---|---|
| intracellular | intracellular | LOCATE | |||||
| intracellular | intracellular | ComPPI | |||||
| intracellular | intracellular | GO_Intercell | |||||
| intracellular | intracellular | UniProt_location | |||||
| intracellular | intracellular | OmniPath |
Protein Complex Composition (15)
15 records.
| Component Name | Component Gene Symbols | Component UniProt ID | Stoichiometry | Database | Database IDs | References |
|---|---|---|---|---|---|---|
| HINT1-SP1 complex | HINT1SP1 | P08047P49773 | 0:0 | CORUM | CORUM:7326 | 19112177 |
| HINT1-TIP60 complex | HINT1KAT5 | P49773Q92993 | 0:0 | CORUM | CORUM:7324 | 16835243 |
| HINT1-UBC3-RBX1 complex | CDC34HINT1RBX1 | P49427P49773P62877 | 0:0:0 | CORUM | CORUM:7325 | 19112177 |
| HINT1LTA4HNT5DC1PGPPITPNBTRAP1VCL | A6NDG6P09960P18206P48739P49773Q12931Q5TFE4 | 0:0:0:0:0:0:0 | hu.MAP2 | |||
| AKR1B10AKR1B15GPX4HINT1TAGLN | C9JRZ8O60218P36969P49773Q01995 | 0:0:0:0:0 | hu.MAP | |||
| AKR1B10AKR1B15HINT1 | C9JRZ8O60218P49773 | 0:0:0 | hu.MAP | |||
| DBIFABP5HINT1HSPE1PGM5PMP2 | P02689P07108P49773P61604Q01469Q15124 | 0:0:0:0:0:0 | hu.MAP | |||
| HINT1PMP2RGN | P02689P49773Q15493 | 0:0:0 | hu.MAP | |||
| HINT1ME3PMP2 | P02689P49773Q16798 | 0:0:0 | hu.MAP | |||
| HINT1LTA4HTRAP1 | P09960P49773Q12931 | 0:0:0 | hu.MAP2 |
Page 1 of 2Next
Isolation & Detection Technology (1)
1 record.
| EV Isolation Method | Detection Method | Number of References | References |
|---|---|---|---|
| Differential UltracentrifugationSize Exclusion Chromatography | Mass spectrometry | 1 | 38037300 |
Sequence, Structure & Domains
Sequences
Length
126
Mass
13,802
Sequence
MADEIAKAQVARPGGDTIFGKIIRKEIPAKIIFEDDRCLAFHDISPQAPTHFLVIPKKHISQISVAEDDDESLLGHLMIVGKKCAADLGLNKGYRMVVNEGSDGGQSVYHVHLHVLGGRQMHWPPG
3D Structural Models
Helix
18..23; 63..65; 68..70; 71..87; 101..104
Beta Strand
31..34; 36..42; 47..58; 94..100; 108..110; 113..119
3D Structure
X-ray crystallography (59)
Domain & Motif Annotations
Motif
110..114; Histidine triad motif
Domain (FT)
18..126; HIT
Protein Families
HINT family
Sequence Similarities
Belongs to the HINT family.
Clinical Relevance
Supporting Publications1
| PMID | Title | Related sentences |
|---|---|---|
| 27605433 | Secreted primary human malignant mesothelioma exosome signature reflects oncogenic cargo. | No related sentences available |