Protein detail

GDIB

Rab GDP dissociation inhibitor beta (Rab GDI beta) (Guanosine diphosphate dissociation inhibitor 2) (GDI-2)

Entry name GDIB	UniProt ID P50395	EVMP confidence score 0.50
Supporting publications (n) 1	Transmembrane count	Protein classification Plasma proteinsPredicted intracellular proteins

EVMP confidence score

Annotation confidence score; open for threshold definitions.

Extremely high >= 0.85High >= 0.70Medium >= 0.55Low >= 0.40

Basic Information11

Protein Names

Rab GDP dissociation inhibitor beta (Rab GDI beta) (Guanosine diphosphate dissociation inhibitor 2) (GDI-2)

Protein Class (2)

Plasma proteinsPredicted intracellular proteins

Protein Function

Predicted intracellular proteins

Ensembl

ENSG00000057608

Entrez Gene Symbol

GDI2

Gene Synonym

RABGDIB

Gene Description

GDP dissociation inhibitor 2

Chromosome

Position

5765223-5842132

Supporting publications (n)

EVMP confidence score

0.50

Function & Pathway5

Protein Function

Predicted intracellular proteins

Cellular Component (11)

Page 1 of 2

Molecular Function (5)

Reactome (6)

Mediation Categories (4)

Adhesion and uptake mediationFusion and delivery mediationImmune mediationReceptor-signaling mediation

Relations & Evidence35

Enzyme-Mediated Modification (2)

2 records.

Substrate Gene Symbol	Enzyme Gene Symbol	Enzyme UniProt ID	Residue Type	Residue Offset	Modification	Database	References
GDI2	PAK1	Q13153	T	248	phosphorylation	PhosphoSite
GDI2	PAK1	Q13153	S	382	phosphorylation	PhosphoSite

Ligand-Receptor Signaling (7)

7 records.

Category	Parent	Database	Transmitter	Receiver	Secreted	Plasma Membrane (Transmembrane)	Plasma Membrane (Peripheral)
ecm	ecm	MatrixDB	Yes	No	No	No	No
ecm	ecm	OmniPath	Yes	No	No	No	No
intracellular	intracellular	LOCATE	No	No	No	No	No
intracellular	intracellular	ComPPI	No	No	No	No	No
intracellular	intracellular	GO_Intercell	No	No	No	No	No
intracellular	intracellular	UniProt_location	No	No	No	No	No
intracellular	intracellular	OmniPath	No	No	No	No	No

Regulatory Interaction Network (1)

1 record.

Source Protein Symbol	Source UniProt ID	Target Protein Symbol	Target UniProt ID	Is Directed	Is Stimulation	Is Inhibition	Database	References
PAK1	Q13153	GDIB	P50395	Yes	No	No	PhosphoSite_norefPhosphoSitePhosphoSite_ProtMapperProtMapper	PhosphoSite:33914026

Protein Complex Composition (24)

24 records.

Component Gene Symbols	Component UniProt ID	Stoichiometry	Database
GDI2 RAB1A RAB8B	P50395 P62820 Q92930	0:0:0	hu.MAP
GDI2 RAB1B RAB8B	P50395 Q92930 Q9H0U4	0:0:0	hu.MAP
AS3MT GDI2 RAB1B RAB8B	P50395 Q92930 Q9H0U4 Q9HBK9	0:0:0:0	hu.MAP
GDI2 RAB1B	P50395 Q9H0U4	0:0	hu.MAP

Page 3 of 3Previous

Isolation & Detection Technology (1)

1 record.

EV Isolation Method	Detection Method	Number of References	References
Differential UltracentrifugationUltrafiltration / Tangential Flow FiltrationSize Exclusion Chromatography	Mass spectrometry	3	37786918 27894104 38321535

Sequence, Structure & Domains7

Sequences

Length

445

Mass

50,663

Sequence

MNEEYDVIVLGTGLTECILSGIMSVNGKKVLHMDRNPYYGGESASITPLEDLYKRFKIPGSPPESMGRGRDWNVDLIPKFLMANGQLVKMLLYTEVTRYLDFKVTEGSFVYKGGKIYKVPSTEAEALASSLMGLFEKRRFRKFLVYVANFDEKDPRTFEGIDPKKTTMRDVYKKFDLGQDVIDFTGHALALYRTDDYLDQPCYETINRIKLYSESLARYGKSPYLYPLYGLGELPQGFARLSAIYGGTYMLNKPIEEIIVQNGKVIGVKSEGEIARCKQLICDPSYVKDRVEKVGQVIRVICILSHPIKNTNDANSCQIIIPQNQVNRKSDIYVCMISFAHNVAAQGKYIAIVSTTVETKEPEKEIRPALELLEPIEQKFVSISDLLVPKDLGTESQIFISRTYDATTHFETTCDDIKNIYKRMTGSEFDFEEMKRKKNDIYGED

Alternative Products

Event=Alternative splicing; Named isoforms=2; Name=1; IsoId=P50395-1; Sequence=Displayed; Name=2; IsoId=P50395-2; Sequence=VSP_043469

Alternative Sequence

86..130; Missing (in isoform 2)

Domain & Motif Annotations

Protein Families

Rab GDI family

Sequence Similarities

Belongs to the Rab GDI family.

Clinical Relevance5

Drugs

PF-9363

Antibody (2)

HPA049290 HPA057668

Interaction Protein (15)

ENSG00000080371ENSG00000084733ENSG00000104388ENSG00000105649ENSG00000108774ENSG00000111737ENSG00000123595ENSG00000129472ENSG00000138069ENSG00000144566ENSG00000154917ENSG00000168118ENSG00000169228ENSG00000174903ENSG00000203879

Interaction Count

Interaction Dataset (5)

biogrid_opencellbiogrid_bioplexbiogrid_opencell_bioplexintact_biogrid_bioplexintact_biogrid_opencell_bioplex

Supporting Publications1

PMID	Title	Abstract
38321535	Identification of specific markers for human pluripotent stem cell-derived small extracellular vesicles.	No abstract available