Protein detail
TUB
Tubby protein homolog
Entry name TUB | UniProt ID | EVMP confidence score 0.50 |
Supporting publications (n) 6 | Transmembrane count | Protein classification Disease related genesPredicted intracellular proteins |
EVMP confidence score
Annotation confidence score; open for threshold definitions.
Extremely high >= 0.85High >= 0.70Medium >= 0.55Low >= 0.40Basic Information11
Protein Names
Tubby protein homolog
Protein Class (2)
Disease related genesPredicted intracellular proteins
Protein Function (2)
- Disease related genes
- Predicted intracellular proteins
Ensembl
Entrez Gene Symbol
Gene Synonym
rd5
Gene Description
TUB bipartite transcription factor
Chromosome
11
Position
8019244-8106243
Supporting publications (n)
6
EVMP confidence score
0.50
Fluorescence & Localization5
Cell SpecificMicrogliaSingle-Nuclei Brain Specificcentral nervous system macrophageBlood Cell SpecificeosinophilBlood Lineage Specificgranulocytes
Function & Pathway5
Protein Function (2)
- Disease related genes
- Predicted intracellular proteins
Cellular Component (6)
Molecular Function (3)
Biological Process (3)
Mediation Categories (3)
Clinical-translation mediationImmune mediationReceptor-signaling mediation
Relations & Evidence188
Ligand-Receptor Signaling (17)
17 records.
| Category | Parent | Database | Transmitter | Receiver | Secreted | Plasma Membrane (Transmembrane) | Plasma Membrane (Peripheral) |
|---|---|---|---|---|---|---|---|
| receptor | receptor | OmniPath | No | Yes | Yes | No | No |
| ecm | ecm | MatrixDB | Yes | No | Yes | No | No |
| ecm | ecm | OmniPath | Yes | No | Yes | No | No |
| extracellular | extracellular | OmniPath | No | No | Yes | No | No |
| intracellular | intracellular | LOCATE | No | No | Yes | No | No |
| intracellular | intracellular | ComPPI | No | No | Yes | No | No |
| intracellular | intracellular | GO_Intercell | No | No | Yes | No | No |
| intracellular | intracellular | UniProt_location | No | No | Yes | No | No |
| intracellular | intracellular | OmniPath | No | No | Yes | No | No |
| plasma_membrane | plasma_membrane | UniProt_location | No | No | Yes | No | No |
Page 1 of 2Next
Protein Complex Composition (170)
170 records.
| Component Name | Component Gene Symbols | Component UniProt ID | Stoichiometry | Database | Database IDs | References |
|---|---|---|---|---|---|---|
| ARL2CAPSTUBB2B | P36404Q13938Q9BVA1 | 0:0:0 | hu.MAP2 | |||
| ABCF2EIF2S3TUBA1B | P41091P68363Q9UG63 | 0:0:0 | hu.MAP | |||
| CLIP4DYNC1H1HCFC1KIF5APAFAH1B1TUBA1A | P43034P51610Q12840Q14204Q71U36Q8N3C7 | 1:1:1:1:1:1 | NetworkBlastCompleat | Compleat:HC8824 | ||
| CLIP4DYNC1H1PAFAH1B1PHB2TIMM50TUBA3E | P43034Q14204Q3ZCQ8Q6PEY2Q8N3C7Q99623 | 1:1:1:1:1:1 | NetworkBlastCompleat | Compleat:HC9241 | ||
| TUBA1BTUBB3 | P68363Q13509 | 8:8 | PDB | PDB:7pjfPDB:7m18PDB:6e7bPDB:9f3bPDB:6s8lPDB:7sj7PDB:5ij9PDB:9f3hPDB:8vt7PDB:5ij0PDB:7sj8PDB:7sjaPDB:7lxbPDB:7m20 | ||
| MATCAP1TUBA1BTUBB3 | P68363Q13509Q68EN5 | 2:2:2 | PDB | PDB:7z6s | ||
| MAPRE3TUBA1BTUBB3 | P68363Q13509Q9UPY8 | 6:6:2 | PDB | PDB:9f3rPDB:9f3sPDB:7sj9 | ||
| LTV1RCN1TUBA1BTUBB2ATUBB2B | P68363Q13885Q15293Q96GA3Q9BVA1 | 0:0:0:0:0 | Havugimana2012 | Havugimana2012:C_406 | ||
| TCP11L2TUBA1BTUBA3E | P68363Q6PEY2Q8N4U5 | 0:0:0 | hu.MAP2 | |||
| SVBPTUBA1BVASH1 | P68363Q7L8A9Q8N300 | 1:1:1 | PDB | PDB:6j8o |
Sequence, Structure & Domains13
Sequences
Length
506
Mass
55,651
Sequence
MTSKPHSDWIPYSVLDDEGRNLRQQKLDRQRALLEQKQKKKRQEPLMVQANADGRPRSRRARQSEEQAPLVESYLSSSGSTSYQVQEADSLASVQLGATRPTAPASAKRTKAAATAGGQGGAARKEKKGKHKGTSGPAALAEDKSEAQGPVQILTVGQSDHAQDAGETAAGGGERPSGQDLRATMQRKGISSSMSFDEDEEDEEENSSSSSQLNSNTRPSSATSRKSVREAASAPSPTAPEQPVDVEVQDLEEFALRPAPQGITIKCRITRDKKGMDRGMYPTYFLHLDREDGKKVFLLAGRKRKKSKTSNYLISVDPTDLSRGGDSYIGKLRSNLMGTKFTVYDNGVNPQKASSSTLESGTLRQELAAVCYETNVLGFKGPRKMSVIVPGMNMVHERVSIRPRNEHETLLARWQNKNTESIIELQNKTPVWNDDTQSYVLNFHGRVTQASVKNFQIIHGNDPDYIVMQFGRVAEDVFTMDYNYPLCALQAFAIALSSFDSKLACE
Alternative Products
Event=Alternative splicing; Named isoforms=2; Name=1; IsoId=P50607-1; Sequence=Displayed; Name=2; IsoId=P50607-2; Sequence=VSP_023030
Alternative Sequence
1..13; MTSKPHSDWIPYS -> MGARTPLPSFWVSFFAETGILFPGGTPWPMGSQHSKQHRKPGPLKRGHRRDRRTTRRKYWKEGREIAR (in isoform 2)
3D Structural Models
Turn
355..357; 434..437
Helix
251..255; 276..278; 318..322; 406..408; 410..415; 488..500
Beta Strand
265..272; 283..289; 295..303; 311..316; 329..334; 338..348; 358..363; 366..372; 385..390; 421..427; 431..433; 438..440; 455..459; 467..474; 477..482
3D Structure
X-ray crystallography (1)
Domain & Motif Annotations
Compositional Bias
70..87; Low complexity; 101..116; Low complexity; 196..206; Acidic residues; 207..221; Low complexity; 230..243; Low complexity
Region
36..244; Disordered
Protein Families
TUB family
Sequence Similarities
Belongs to the TUB family.
Clinical Relevance5
Disease Involvement
Obesity
Related Diseases (11)
Biomarker
Discontinued in Phase 3; Phase 1; Approved; Investigative; Discontinued in Phase 1; Phase 3; Phase 2
Drugs (17)
Supporting Publications6
| PMID | Title | Abstract |
|---|---|---|
| 33709510 | Unbiased proteomic profiling of host cell extracellular vesicle composition and dynamics upon HIV-1 infection. | No abstract available |
| 35111156 | Exosomes Recovered From the Plasma of COVID-19 Patients Expose SARS-CoV-2 Spike-Derived Fragments and Contribute to the Adaptive Immune Response. | No abstract available |
| 37686366 | Identification of a Non-Invasive Urinary Exosomal Biomarker for Diabetic Nephropathy Using Data-Independent Acquisition Proteomics. | No abstract available |
| 38321535 | Identification of specific markers for human pluripotent stem cell-derived small extracellular vesicles. | No abstract available |
| 39290459 | Urinary extracellular vesicles as a monitoring tool for renal damage in patients not meeting criteria for chronic kidney disease. | No abstract available |
| 40091455 | Potential Role of Menstrual Fluid-Derived Small Extracellular Vesicle Proteins in Endometriosis Pathogenesiss. | No abstract available |