Protein detail

BCAM

Basal cell adhesion molecule (Auberger B antigen) (B-CAM cell surface glycoprotein) (F8/G253 antigen) (Lutheran antigen) (Lutheran blood group glycoprotein) (CD antigen CD239)

Entry name BCAM	UniProt ID P50895	EVMP confidence score 0.63
Supporting publications (n) 27	Transmembrane count 1	Protein classification Blood group antigen proteinsCD markersPlasma proteinsPredicted intracellular proteinsPredicted membrane proteins

EVMP confidence score

Annotation confidence score; open for threshold definitions.

Extremely high >= 0.85High >= 0.70Medium >= 0.55Low >= 0.40

Basic Information13

Protein Names

Basal cell adhesion molecule (Auberger B antigen) (B-CAM cell surface glycoprotein) (F8/G253 antigen) (Lutheran antigen) (Lutheran blood group glycoprotein) (CD antigen CD239)

Protein Class (5)

Blood group antigen proteinsCD markersPlasma proteinsPredicted intracellular proteinsPredicted membrane proteins

Protein Function (3)

Blood group antigen proteins
CD markers
Predicted intracellular proteins

Transmembrane

548..568; Helical

Transmembrane Count

Ensembl

ENSG00000187244

Entrez Gene Symbol

BCAM

Gene Synonym (2)

CD239LU

Gene Description

Basal cell adhesion molecule (Lutheran blood group)

Chromosome

Position

44809071-44821421

Supporting publications (n)

EVMP confidence score

0.63

Fluorescence & Localization4

Tissue SpecifickidneyCell SpecificLoop of henle epithelial cellsSingle-Nuclei Brain Specificlower rhombic lip

Function & Pathway5

Protein Function (3)

Blood group antigen proteins
CD markers
Predicted intracellular proteins

Cellular Component (5)

Molecular Function (4)

Biological Process (3)

Mediation Categories (2)

Adhesion and uptake mediationFusion and delivery mediation

Relations & Evidence58

Enzyme-Mediated Modification (3)

3 records.

Substrate Gene Symbol	Enzyme Gene Symbol	Enzyme UniProt ID	Residue Type	Residue Offset	Modification	Database
BCAM	CSNK2A1	P68400	S	598	phosphorylation	PhosphoSite_MIMPMIMPProtMapperPhosphoSitePhosphoSite_ProtMapper
BCAM	PRKACA	P17612	S	621	phosphorylation	PhosphoSite_MIMPMIMPProtMapperPhosphoSitePhosphoSite_ProtMapper
BCAM	GSK3B	P49841	S	596	phosphorylation	PhosphoSite_MIMPMIMPProtMapperPhosphoSitePhosphoSite_ProtMapper

Ligand-Receptor Signaling (52)

52 records.

Category	Parent	Database	Transmitter	Receiver	Secreted	Plasma Membrane (Transmembrane)	Plasma Membrane (Peripheral)
intracellular	intracellular	LOCATE	No	No	No	Yes	No
intracellular	intracellular	ComPPI	No	No	No	Yes	No
intracellular	intracellular	OmniPath	No	No	No	Yes	No
ig_like	cell_adhesion	HGNC	Yes	Yes	No	Yes	No
adhesion	adhesion	HGNC	Yes	Yes	No	Yes	No
adhesion	adhesion	MCAM	Yes	Yes	No	Yes	No
ig_like	adhesion	Almen2009	Yes	Yes	No	Yes	No
cell_adhesion	cell_adhesion	Cellinker	Yes	Yes	No	Yes	No
cell_adhesion	cell_adhesion	Zhong2015	Yes	Yes	No	Yes	No
icam	cell_adhesion	Zhong2015	Yes	Yes	No	Yes	No

Page 2 of 6Previous Next

Regulatory Interaction Network (1)

1 record.

Source Protein Symbol	Source UniProt ID	Target Protein Symbol	Target UniProt ID	Is Directed	Is Stimulation	Is Inhibition	Database	References
KAPCA	P17612	BCAM	P50895	Yes	No	No	PhosphoSite_MIMPMIMPiPTMnetProtMapperPhosphoSitePhosphoSite_ProtMapper	PhosphoSite:15975931 PhosphoSite:31413112

Protein Complex Composition (1)

1 record.

Component Name	Component Gene Symbols	Component UniProt ID	Stoichiometry	Database	Database IDs	References
	BCAM	P50895	2	PDB	PDB:2pf6

Isolation & Detection Technology (1)

1 record.

EV Isolation Method	Detection Method	Number of References	References
Differential UltracentrifugationSize Exclusion Chromatography	Western blottingELISA	3	26775013 39478498 37922300

Sequence, Structure & Domains9

Sequences

Length

628

Mass

67,405

Sequence

MEPPDAPAQARGAPRLLLLAVLLAAHPDAQAEVRLSVPPLVEVMRGKSVILDCTPTGTHDHYMLEWFLTDRSGARPRLASAEMQGSELQVTMHDTRGRSPPYQLDSQGRLVLAEAQVGDERDYVCVVRAGAAGTAEATARLNVFAKPEATEVSPNKGTLSVMEDSAQEIATCNSRNGNPAPKITWYRNGQRLEVPVEMNPEGYMTSRTVREASGLLSLTSTLYLRLRKDDRDASFHCAAHYSLPEGRHGRLDSPTFHLTLHYPTEHVQFWVGSPSTPAGWVREGDTVQLLCRGDGSPSPEYTLFRLQDEQEEVLNVNLEGNLTLEGVTRGQSGTYGCRVEDYDAADDVQLSKTLELRVAYLDPLELSEGKVLSLPLNSSAVVNCSVHGLPTPALRWTKDSTPLGDGPMLSLSSITFDSNGTYVCEASLPTVPVLSRTQNFTLLVQGSPELKTAEIEPKADGSWREGDEVTLICSARGHPDPKLSWSQLGGSPAEPIPGRQGWVSSSLTLKVTSALSRDGISCEASNPHGNKRHVFHFGTVSPQTSQAGVAVMAVAVSVGLLLLVVAVFYCVRRKGGPCCRQRREKGAPPPGEPGLSHSGSEQPEQTGLLMGGASGGARGGSGGFGDEC

3D Structural Models

Helix

117..119; 130..132; 228..232; 244..246

Beta Strand

34..36; 39..44; 49..51; 54..57; 60..69; 77..84; 87..92; 110..114; 121..128; 134..145; 151..154; 167..179; 182..187; 190..192; 200..210; 216..224; 234..242; 248..252

3D Structure

X-ray crystallography (2)

Domain & Motif Annotations

Compositional Bias

609..628; Gly residues

Domain (FT)

32..142; Ig-like V-type 1; 147..257; Ig-like V-type 2; 274..355; Ig-like C2-type 1; 363..441; Ig-like C2-type 2; 448..541; Ig-like C2-type 3

Region

309..312; Interaction with laminin alpha5; 579..628; Disordered

Clinical Relevance1

Antibody

HPA005654

Supporting Publications27

PMID	Title	Abstract
23161513	Proteomic analysis of exosomes from mutant KRAS colon cancer cells identifies intercellular transfer of mutant KRAS.	Exosomes from mutant KRAS cells contain many tumor-promoting proteins, including KRAS, EGFR, SRC family kinases, and integrins.
26378940	Redefining the Breast Cancer Exosome Proteome by Tandem Mass Tag Quantitative Proteomics and Multivariate Cluster Analysis.	No abstract available
27863537	High-resolution proteomic and lipidomic analysis of exosomes and microvesicles from different cell sources.	No abstract available
27894104	Proteomic profiling of NCI-60 extracellular vesicles uncovers common protein cargo and cancer type-specific biomarkers.	No abstract available
28590090	Motile hepatocellular carcinoma cells preferentially secret sugar metabolism regulatory proteins via exosomes.	No abstract available
28986585	Quantitation of putative colorectal cancer biomarker candidates in serum extracellular vesicles by targeted proteomics.	No abstract available
29148239	Metabolic Signature of Microvesicles from Umbilical Cord Mesenchymal Stem Cells of Preterm and Term Infants.	No abstract available
29436780	Autosomal Tubulointerstitial Kidney Disease-MUC1 Type: Differential Proteomics Suggests that Mutated MUC1 (insC) Affects Vesicular Transport in Renal Epithelial Cells.	No abstract available
30408591	Portrait of blood-derived extracellular vesicles in patients with Parkinson's disease.	No abstract available
30646616	Preferential Localization of MUC1 Glycoprotein in Exosomes Secreted by Non-Small Cell Lung Carcinoma Cells.	THBS1, ANXA6, HIST1H4A, COL18A1, MDK, SRGN, ENO1, TUBA4A, SLC3A2, GPI, MIF, MUC1, TALDO1, SLC7A5, ICAM1, HSP90AA1, G6PD, and LRP1 were found to be expressed in exosomes at more than 5-fold higher level as compared to total cellular membrane proteins.

Page 1 of 3Next