Protein detail
BCAM
Basal cell adhesion molecule (Auberger B antigen) (B-CAM cell surface glycoprotein) (F8/G253 antigen) (Lutheran antigen) (Lutheran blood group glycoprotein) (CD antigen CD239)
Entry name BCAM | UniProt ID | EVMP confidence score 0.75 |
Supporting publications (n) 27 | Transmembrane count 1 | Protein classification Blood group antigen proteinsCD markersPlasma proteinsPredicted intracellular proteinsPredicted membrane proteins |
Annotation confidence score; open for threshold definitions.
Extremely high >= 0.70High >= 0.60Medium >= 0.40Low >= 0.30Basic Information
Protein Names
Basal cell adhesion molecule (Auberger B antigen) (B-CAM cell surface glycoprotein) (F8/G253 antigen) (Lutheran antigen) (Lutheran blood group glycoprotein) (CD antigen CD239)
Protein Class (5)
Blood group antigen proteinsCD markersPlasma proteinsPredicted intracellular proteinsPredicted membrane proteins
Protein Function (3)
- Blood group antigen proteins
- CD markers
- Predicted intracellular proteins
Transmembrane
548..568; Helical
Transmembrane Count
1
Ensembl
Entrez Gene Symbol
Gene Synonym (2)
CD239LU
Gene Description
Basal cell adhesion molecule (Lutheran blood group)
Chromosome
19
Position
44809071-44821421
Supporting publications (n)
27
EVMP confidence score
0.75
Fluorescence & Localization
Tissue SpecifickidneyCell SpecificLoop of henle epithelial cellsSingle-Nuclei Brain Specificlower rhombic lip
Function & Pathway
Protein Function (3)
- Blood group antigen proteins
- CD markers
- Predicted intracellular proteins
Cellular Component (5)
Molecular Function (4)
Biological Process (3)
Mediation Categories (2)
Adhesion and uptake mediationFusion and delivery mediation
Relations & Evidence58
Enzyme-Mediated Modification (3)
3 records.
| Substrate Gene Symbol | Enzyme Gene Symbol | Enzyme UniProt ID | Residue Type | Residue Offset | Modification | Database | References |
|---|---|---|---|---|---|---|---|
| BCAM | CSNK2A1 | P68400 | S | 598 | phosphorylation | PhosphoSite_MIMPMIMPProtMapperPhosphoSitePhosphoSite_ProtMapper | |
| BCAM | PRKACA | P17612 | S | 621 | phosphorylation | PhosphoSite_MIMPMIMPProtMapperPhosphoSitePhosphoSite_ProtMapper | |
| BCAM | GSK3B | P49841 | S | 596 | phosphorylation | PhosphoSite_MIMPMIMPProtMapperPhosphoSitePhosphoSite_ProtMapper |
Ligand-Receptor Signaling (52)
52 records.
| Category | Parent | Database | Transmitter | Receiver | Secreted | Plasma Membrane (Transmembrane) | Plasma Membrane (Peripheral) |
|---|---|---|---|---|---|---|---|
| intracellular | intracellular | LOCATE | Yes | ||||
| intracellular | intracellular | ComPPI | Yes | ||||
| intracellular | intracellular | OmniPath | Yes | ||||
| ig_like | cell_adhesion | HGNC | Yes | Yes | Yes | ||
| adhesion | adhesion | HGNC | Yes | Yes | Yes | ||
| adhesion | adhesion | MCAM | Yes | Yes | Yes | ||
| ig_like | adhesion | Almen2009 | Yes | Yes | Yes | ||
| cell_adhesion | cell_adhesion | Cellinker | Yes | Yes | Yes | ||
| cell_adhesion | cell_adhesion | Zhong2015 | Yes | Yes | Yes | ||
| icam | cell_adhesion | Zhong2015 | Yes | Yes | Yes |
Regulatory Interaction Network (1)
1 record.
| Source Protein Symbol | Source UniProt ID | Target Protein Symbol | Target UniProt ID | Is Directed | Is Stimulation | Is Inhibition | Database | References |
|---|---|---|---|---|---|---|---|---|
| KAPCA | P17612 | BCAM | P50895 | Yes | PhosphoSite_MIMPMIMPiPTMnetProtMapperPhosphoSitePhosphoSite_ProtMapper | PhosphoSite:15975931PhosphoSite:31413112 |
Protein Complex Composition (1)
Sequence, Structure & Domains
Sequences
Length
628
Mass
67,405
Sequence
MEPPDAPAQARGAPRLLLLAVLLAAHPDAQAEVRLSVPPLVEVMRGKSVILDCTPTGTHDHYMLEWFLTDRSGARPRLASAEMQGSELQVTMHDTRGRSPPYQLDSQGRLVLAEAQVGDERDYVCVVRAGAAGTAEATARLNVFAKPEATEVSPNKGTLSVMEDSAQEIATCNSRNGNPAPKITWYRNGQRLEVPVEMNPEGYMTSRTVREASGLLSLTSTLYLRLRKDDRDASFHCAAHYSLPEGRHGRLDSPTFHLTLHYPTEHVQFWVGSPSTPAGWVREGDTVQLLCRGDGSPSPEYTLFRLQDEQEEVLNVNLEGNLTLEGVTRGQSGTYGCRVEDYDAADDVQLSKTLELRVAYLDPLELSEGKVLSLPLNSSAVVNCSVHGLPTPALRWTKDSTPLGDGPMLSLSSITFDSNGTYVCEASLPTVPVLSRTQNFTLLVQGSPELKTAEIEPKADGSWREGDEVTLICSARGHPDPKLSWSQLGGSPAEPIPGRQGWVSSSLTLKVTSALSRDGISCEASNPHGNKRHVFHFGTVSPQTSQAGVAVMAVAVSVGLLLLVVAVFYCVRRKGGPCCRQRREKGAPPPGEPGLSHSGSEQPEQTGLLMGGASGGARGGSGGFGDEC
3D Structural Models
Helix
117..119; 130..132; 228..232; 244..246
Beta Strand
34..36; 39..44; 49..51; 54..57; 60..69; 77..84; 87..92; 110..114; 121..128; 134..145; 151..154; 167..179; 182..187; 190..192; 200..210; 216..224; 234..242; 248..252
3D Structure
X-ray crystallography (2)
Domain & Motif Annotations
Compositional Bias
609..628; Gly residues
Domain (FT)
32..142; Ig-like V-type 1; 147..257; Ig-like V-type 2; 274..355; Ig-like C2-type 1; 363..441; Ig-like C2-type 2; 448..541; Ig-like C2-type 3
Region
309..312; Interaction with laminin alpha5; 579..628; Disordered
Clinical Relevance
Antibody
Supporting Publications27
| PMID | Title | Related sentences |
|---|---|---|
| 23161513 | Proteomic analysis of exosomes from mutant KRAS colon cancer cells identifies intercellular transfer of mutant KRAS. | Exosomes from mutant KRAS cells contain many tumor-promoting proteins, including KRAS, EGFR, SRC family kinases, and integrins. |
| 26378940 | Redefining the Breast Cancer Exosome Proteome by Tandem Mass Tag Quantitative Proteomics and Multivariate Cluster Analysis. | No related sentences available |
| 27863537 | High-resolution proteomic and lipidomic analysis of exosomes and microvesicles from different cell sources. | No related sentences available |
| 27894104 | Proteomic profiling of NCI-60 extracellular vesicles uncovers common protein cargo and cancer type-specific biomarkers. | No related sentences available |
| 28590090 | Motile hepatocellular carcinoma cells preferentially secret sugar metabolism regulatory proteins via exosomes. | No related sentences available |
| 28986585 | Quantitation of putative colorectal cancer biomarker candidates in serum extracellular vesicles by targeted proteomics. | No related sentences available |
| 29148239 | Metabolic Signature of Microvesicles from Umbilical Cord Mesenchymal Stem Cells of Preterm and Term Infants. | No related sentences available |
| 29436780 | Autosomal Tubulointerstitial Kidney Disease-MUC1 Type: Differential Proteomics Suggests that Mutated MUC1 (insC) Affects Vesicular Transport in Renal Epithelial Cells. | No related sentences available |
| 30408591 | Portrait of blood-derived extracellular vesicles in patients with Parkinson's disease. | No related sentences available |
| 30646616 | Preferential Localization of MUC1 Glycoprotein in Exosomes Secreted by Non-Small Cell Lung Carcinoma Cells. | THBS1, ANXA6, HIST1H4A, COL18A1, MDK, SRGN, ENO1, TUBA4A, SLC3A2, GPI, MIF, MUC1, TALDO1, SLC7A5, ICAM1, HSP90AA1, G6PD, and LRP1 were found to be expressed in exosomes at more than 5-fold higher level as compared to total cellular membrane proteins. |
Page 1 of 3Next