Protein detail

BCAM

Basal cell adhesion molecule (Auberger B antigen) (B-CAM cell surface glycoprotein) (F8/G253 antigen) (Lutheran antigen) (Lutheran blood group glycoprotein) (CD antigen CD239)

Protein symbol BCAM	UniProt ID P50895	EVMP score 0.63
Frequency 27	Transmembrane count 1	Protein classification Blood group antigen proteinsCD markersPlasma proteinsPredicted intracellular proteinsPredicted membrane proteins

Basic Information

Protein Names

Basal cell adhesion molecule (Auberger B antigen) (B-CAM cell surface glycoprotein) (F8/G253 antigen) (Lutheran antigen) (Lutheran blood group glycoprotein) (CD antigen CD239)

Protein Class

Blood group antigen proteinsCD markersPlasma proteinsPredicted intracellular proteinsPredicted membrane proteins

Protein Function

Blood group antigen proteins
CD markers
Predicted intracellular proteins

Transmembrane

548..568; Helical

Transmembrane Count

Ensembl

ENSG00000187244

Entrez Gene Symbol

BCAM

Gene Synonym

CD239LU

Gene Description

Basal cell adhesion molecule (Lutheran blood group)

Chromosome

Position

44809071-44821421

Frequency

EVMP Score

0.63

Fluorescence & Localization

Tissue SpecifickidneyCell SpecificLoop of henle epithelial cellsSingle-Nuclei Brain Specificlower rhombic lip

Function & Pathway

Protein Function

Blood group antigen proteins
CD markers
Predicted intracellular proteins

Cellular Component

Molecular Function

Biological Process

Mediation Categories

Adhesion and uptake mediationFusion and delivery mediation

Relations & Evidence

Enzyme-Mediated Modification

3 records.

Substrate Gene Symbol	Enzyme Gene Symbol	Enzyme UniProt ID	Residue Type	Residue Offset	Modification	Database
BCAM	CSNK2A1	P68400	S	598	phosphorylation	PhosphoSite_MIMPMIMPProtMapperPhosphoSitePhosphoSite_ProtMapper
BCAM	PRKACA	P17612	S	621	phosphorylation	PhosphoSite_MIMPMIMPProtMapperPhosphoSitePhosphoSite_ProtMapper
BCAM	GSK3B	P49841	S	596	phosphorylation	PhosphoSite_MIMPMIMPProtMapperPhosphoSitePhosphoSite_ProtMapper

Ligand-Receptor Signaling

52 records.

Category	Parent	Database	Transmitter	Receiver	Secreted	Plasma Membrane (Transmembrane)	Plasma Membrane (Peripheral)
cell_adhesion	cell_adhesion	HGNC	Yes	Yes	No	Yes	No
matrix_adhesion	matrix_adhesion	Cellinker	No	Yes	No	Yes	No
adhesion	adhesion	OmniPath	Yes	Yes	No	Yes	No
cell_adhesion	cell_adhesion	OmniPath	Yes	Yes	No	Yes	No
matrix_adhesion	matrix_adhesion	OmniPath	No	Yes	No	Yes	No
transmembrane	transmembrane	UniProt_location	No	No	No	Yes	No
transmembrane	transmembrane	UniProt_topology	No	No	No	Yes	No
transmembrane	transmembrane	UniProt_keyword	No	No	No	Yes	No
transmembrane_predicted	transmembrane	OmniPath	No	No	No	Yes	No
transmembrane	transmembrane	GO_Intercell	No	No	No	Yes	No

Page 3 of 6Previous Next

Regulatory Interaction Network

1 record.

Source Protein Symbol	Source UniProt ID	Target Protein Symbol	Target UniProt ID	Is Directed	Is Stimulation	Is Inhibition	Database	References
KAPCA	P17612	BCAM	P50895	Yes	No	No	PhosphoSite_MIMPMIMPiPTMnetProtMapperPhosphoSitePhosphoSite_ProtMapper	PhosphoSite:15975931 PhosphoSite:31413112

Protein Complex Composition

1 record.

Component Name	Component Gene Symbols	Component UniProt ID	Stoichiometry	Database	Database IDs	References
	BCAM	P50895	2	PDB	PDB:2pf6

Isolation & Detection Technology

1 record.

EV Isolation Method	Detection Method	Number of References	References
Differential UltracentrifugationSize Exclusion Chromatography	Western blottingELISA	3	26775013 39478498 37922300

Sequence, Structure & Domains

Sequences

Length

628

Mass

67,405

Sequence

MEPPDAPAQARGAPRLLLLAVLLAAHPDAQAEVRLSVPPLVEVMRGKSVILDCTPTGTHDHYMLEWFLTDRSGARPRLASAEMQGSELQVTMHDTRGRSPPYQLDSQGRLVLAEAQVGDERDYVCVVRAGAAGTAEATARLNVFAKPEATEVSPNKGTLSVMEDSAQEIATCNSRNGNPAPKITWYRNGQRLEVPVEMNPEGYMTSRTVREASGLLSLTSTLYLRLRKDDRDASFHCAAHYSLPEGRHGRLDSPTFHLTLHYPTEHVQFWVGSPSTPAGWVREGDTVQLLCRGDGSPSPEYTLFRLQDEQEEVLNVNLEGNLTLEGVTRGQSGTYGCRVEDYDAADDVQLSKTLELRVAYLDPLELSEGKVLSLPLNSSAVVNCSVHGLPTPALRWTKDSTPLGDGPMLSLSSITFDSNGTYVCEASLPTVPVLSRTQNFTLLVQGSPELKTAEIEPKADGSWREGDEVTLICSARGHPDPKLSWSQLGGSPAEPIPGRQGWVSSSLTLKVTSALSRDGISCEASNPHGNKRHVFHFGTVSPQTSQAGVAVMAVAVSVGLLLLVVAVFYCVRRKGGPCCRQRREKGAPPPGEPGLSHSGSEQPEQTGLLMGGASGGARGGSGGFGDEC

3D Structural Models

Helix

117..119; 130..132; 228..232; 244..246

Beta Strand

34..36; 39..44; 49..51; 54..57; 60..69; 77..84; 87..92; 110..114; 121..128; 134..145; 151..154; 167..179; 182..187; 190..192; 200..210; 216..224; 234..242; 248..252

3D Structure

X-ray crystallography (2)

Domain & Motif Annotations

Compositional Bias

609..628; Gly residues

Domain (FT)

32..142; Ig-like V-type 1; 147..257; Ig-like V-type 2; 274..355; Ig-like C2-type 1; 363..441; Ig-like C2-type 2; 448..541; Ig-like C2-type 3

Region

309..312; Interaction with laminin alpha5; 579..628; Disordered

Clinical Relevance

Antibody

HPA005654