Protein detail

MFAP3

Microfibril-associated glycoprotein 3

Entry name MFAP3	UniProt ID P55082	EVMP confidence score 0.25
Supporting publications (n) 1	Transmembrane count 1	Protein classification Predicted intracellular proteinsPredicted membrane proteins

EVMP confidence score

Annotation confidence score; open for threshold definitions.

Extremely high >= 0.85High >= 0.70Medium >= 0.55Low >= 0.40

Basic Information12

Protein Names

Microfibril-associated glycoprotein 3

Protein Class (2)

Predicted intracellular proteinsPredicted membrane proteins

Protein Function

Predicted intracellular proteins

Transmembrane

148..170; Helical

Transmembrane Count

Ensembl

ENSG00000037749

Entrez Gene Symbol

MFAP3

Gene Description

Microfibril associated protein 3

Chromosome

Position

154038959-154220478

Supporting publications (n)

EVMP confidence score

0.25

Fluorescence & Localization3

Cell SpecificBergmann gliaSingle-Nuclei Brain SpecificBergmann glia

Function & Pathway6

Protein Function

Predicted intracellular proteins

Cellular Component (3)

Molecular Function (3)

Biological Process (3)

Reactome (3)

Mediation Categories (2)

Fusion and delivery mediationReceptor-signaling mediation

Relations & Evidence26

Ligand-Receptor Signaling (23)

23 records.

Category	Parent	Database	Transmitter	Receiver	Secreted	Plasma Membrane (Transmembrane)	Plasma Membrane (Peripheral)
transmembrane	transmembrane	Ramilowski_location	No	No	No	Yes	No
transmembrane	transmembrane	OmniPath	No	No	No	Yes	No
plasma_membrane	plasma_membrane	UniProt_location	No	No	No	Yes	No
plasma_membrane	plasma_membrane	OmniPath	No	No	No	Yes	No
plasma_membrane_transmembrane	plasma_membrane_transmembrane	Membranome	No	No	No	Yes	No
plasma_membrane_transmembrane	plasma_membrane_transmembrane	CSPA	No	No	No	Yes	No
plasma_membrane_transmembrane	plasma_membrane_transmembrane	OmniPath	No	No	No	Yes	No
cell_surface	cell_surface	Surfaceome	No	No	No	Yes	No
cell_surface	cell_surface	OmniPath	No	No	No	Yes	No
glycoprotein	ecm	Matrisome	Yes	No	No	Yes	No

Page 2 of 3Previous Next

Protein Complex Composition (2)

2 records.

Component Name	Component Gene Symbols	Component UniProt ID	Stoichiometry	Database	Database IDs	References
	CCDC28B GON7 HYKK LAGE3 MFAP3 OSGEP TP53RK TPRKB	A2RU49 P55082 Q14657 Q96S44 Q9BUN5 Q9BXV9 Q9NPF4 Q9Y3C4	0:0:0:0:0:0:0:0	hu.MAP
	GON7 LAGE3 MFAP3 OSGEP TP53RK TPRKB	P55082 Q14657 Q96S44 Q9BXV9 Q9NPF4 Q9Y3C4	0:0:0:0:0:0	hu.MAP

Isolation & Detection Technology (1)

1 record.

EV Isolation Method	Detection Method	Number of References	References
Differential UltracentrifugationUltrafiltration / Tangential Flow FiltrationSize Exclusion Chromatography	Mass spectrometry	1	39120316

Sequence, Structure & Domains8

Sequences

Length

362

Mass

40,165

Sequence

MKLHCCLFTLVASIIVPAAFVLEDVDFDQMVSLEANRSSYNASFPSSFELSASSHSDDDVIIAKEGTSVSIECLLTASHYEDVHWHNSKGQQLDGRSRGGKWLVSDNFLNITNVAFDDRGLYTCFVTSPIRASYSVTLRVIFTSGDMSVYYMIVCLIAFTITLILNVTRLCMMSSHLRKTEKAINEFFRTEGAEKLQKAFEIAKRIPIITSAKTLELAKVTQFKTMEFARYIEELARSVPLPPLILNCRAFVEEMFEAVRVDDPDDLGERIKERPALNAQGGIYVINPEMGRSNSPGGDSDDGSLNEQGQEIAVQVSVHLQSETKSIDTESQGSSHFSPPDDIGSAESNCNYKDGAYENCQL

Alternative Products

Event=Alternative splicing; Named isoforms=2; Name=1; IsoId=P55082-1; Sequence=Displayed; Name=2; IsoId=P55082-2; Sequence=VSP_042948

Alternative Sequence

1..146; Missing (in isoform 2)

Domain & Motif Annotations

Compositional Bias

323..337; Polar residues

Domain (FT)

45..137; Ig-like C2-type

Region

285..306; Disordered; 323..350; Disordered

Clinical Relevance1

Antibody (2)

HPA015883 HPA049198

Supporting Publications1

PMID	Title	Abstract
32384937	Alzheimer's disease progression characterized by alterations in the molecular profiles and biogenesis of brain extracellular vesicles.	No abstract available