Protein detail
CAD13
Cadherin-13 (Heart cadherin) (H-cadherin) (P105) (Truncated cadherin) (T-cad) (T-cadherin)
Protein symbol CAD13 | UniProt ID | EVMP score 0.50 |
Frequency 1 | Transmembrane count | Protein classification Plasma proteinsPredicted intracellular proteins |
EVMP score: annotation confidence score.
Extremely high >= 0.85High >= 0.70Medium >= 0.55Low >= 0.40
Basic Information
Protein Names
Cadherin-13 (Heart cadherin) (H-cadherin) (P105) (Truncated cadherin) (T-cad) (T-cadherin)
Protein Class
Plasma proteinsPredicted intracellular proteins
Protein Function
Predicted intracellular proteins
Ensembl
Entrez Gene Symbol
Gene Synonym
CDHH
Gene Description
Cadherin 13
Chromosome
16
Position
82626965-83800640
Frequency
1
EVMP Score
0.50
Fluorescence & Localization
Function & Pathway
Protein Function
Predicted intracellular proteins
Cellular Component
- GO:0005576 extracellular region
- GO:0005615 extracellular space
- GO:0005737 cytoplasm
- GO:0005886 plasma membrane
- GO:0005901 caveola
- GO:0005912 adherens junction
- GO:0005925 focal adhesion
- GO:0009897 external side of plasma membrane
- GO:0016342 catenin complex
- GO:0043005 neuron projection
- GO:0048471 perinuclear region of cytoplasm
- GO:0062023 collagen-containing extracellular matrix
- GO:0070062 extracellular exosome
- GO:0098982 GABA-ergic synapse
Molecular Function
Biological Process
Reactome
Mediation Categories
Adhesion and uptake mediationFusion and delivery mediationReceptor-signaling mediation
Relations & Evidence
Enzyme-Mediated Modification
0 records.
Ligand-Receptor Signaling
33 records.
| Category | Parent | Database | Transmitter | Receiver | Secreted | Plasma Membrane (Transmembrane) | Plasma Membrane (Peripheral) |
|---|---|---|---|---|---|---|---|
| intracellular | intracellular | UniProt_location | No | No | No | No | Yes |
| intracellular | intracellular | OmniPath | No | No | No | No | Yes |
| cell_surface_ligand | cell_surface_ligand | Baccin2019 | Yes | No | No | No | Yes |
| cell_surface_ligand | cell_surface_ligand | OmniPath | Yes | No | No | No | Yes |
| major_cadherin | cell_adhesion | HGNC | Yes | Yes | No | No | Yes |
| adhesion | adhesion | HGNC | Yes | Yes | No | No | Yes |
| cell_adhesion | cell_adhesion | Cellinker | Yes | Yes | No | No | Yes |
| cell_adhesion | cell_adhesion | Zhong2015 | Yes | Yes | No | No | Yes |
| icam | cell_adhesion | Zhong2015 | Yes | Yes | No | No | Yes |
| cell_adhesion | cell_adhesion | HGNC | Yes | Yes | No | No | Yes |
Regulatory Interaction Network
1 record.
| Source Protein Symbol | Source UniProt ID | Target Protein Symbol | Target UniProt ID | Is Directed | Is Stimulation | Is Inhibition | Database | References |
|---|---|---|---|---|---|---|---|---|
| CAD13 | P55290 | CTNB1 | P35222 | Yes | Yes | No | SIGNOR | SIGNOR:21255999 |
Protein Complex Composition
0 records.
Sequence, Structure & Domains
Sequences
Length
713
Mass
78,287
Sequence
MQPRTPLVLCVLLSQVLLLTSAEDLDCTPGFQQKVFHINQPAEFIEDQSILNLTFSDCKGNDKLRYEVSSPYFKVNSDGGLVALRNITAVGKTLFVHARTPHAEDMAELVIVGGKDIQGSLQDIFKFARTSPVPRQKRSIVVSPILIPENQRQPFPRDVGKVVDSDRPERSKFRLTGKGVDQEPKGIFRINENTGSVSVTRTLDREVIAVYQLFVETTDVNGKTLEGPVPLEVIVIDQNDNRPIFREGPYIGHVMEGSPTGTTVMRMTAFDADDPATDNALLRYNIRQQTPDKPSPNMFYIDPEKGDIVTVVSPALLDRETLENPKYELIIEAQDMAGLDVGLTGTATATIMIDDKNDHSPKFTKKEFQATVEEGAVGVIVNLTVEDKDDPTTGAWRAAYTIINGNPGQSFEIHTNPQTNEGMLSVVKPLDYEISAFHTLLIKVENEDPLVPDVSYGPSSTATVHITVLDVNEGPVFYPDPMMVTRQEDLSVGSVLLTVNATDPDSLQHQTIRYSVYKDPAGWLNINPINGTVDTTAVLDRESPFVDNSVYTALFLAIDSGNPPATGTGTLLITLEDVNDNAPFIYPTVAEVCDDAKNLSVVILGASDKDLHPNTDPFKFEIHKQAVPDKVWKISKINNTHALVSLLQNLNKANYNLPIMVTDSGKPPMTNITDLRVQVCSCRNSKVDCNAAGALRFSLPSVLLLSLFSLACL
Alternative Products
Event=Alternative splicing; Named isoforms=5; Name=1; IsoId=P55290-1; Sequence=Displayed; Name=2; IsoId=P55290-2; Sequence=VSP_042696, VSP_042697; Name=3; IsoId=P55290-3; Sequence=VSP_042794, VSP_042795; Name=4; IsoId=P55290-4; Sequence=VSP_046714; Name=5; IsoId=P55290-5; Sequence=VSP_053739
Alternative Sequence
1..14; MQPRTPLVLCVLLS -> MKTPPGASSRTKCSRELRSFCAFSCPRAKQPTCTAWFPQQEHPSENGPQMPGRDPPAASTM (in isoform 4); 123..161; Missing (in isoform 5); 162..190; VVDSDRPERSKFRLTGKGVDQEPKGIFRI -> RTHNPINSELLLNEGITADLNPCITILAI (in isoform 2); 162..175; VVDSDRPERSKFRL -> MKIWQVLCLARWLT (in isoform 3); 176..713; Missing (in isoform 3); 191..713; Missing (in isoform 2)
3D Structural Models
Turn
179..181; 192..194; 205..207
Beta Strand
145..148; 157..161; 163..167; 172..178; 182..184; 187..190; 196..199; 209..218; 224..236; 238..241
3D Structure
NMR spectroscopy (1)
Domain & Motif Annotations
Domain (CC)
Three calcium ions are usually bound at the interface of each cadherin domain and rigidify the connections, imparting a strong curvature to the full-length ectodomain.
Domain (FT)
139..245; Cadherin 1; 246..363; Cadherin 2; 364..477; Cadherin 3; 478..585; Cadherin 4; 584..694; Cadherin 5