Protein detail
CAD13
Cadherin-13 (Heart cadherin) (H-cadherin) (P105) (Truncated cadherin) (T-cad) (T-cadherin)
Entry name CAD13 | UniProt ID | EVMP confidence score 0.53 |
Supporting publications (n) 1 | Transmembrane count | Protein classification Plasma proteinsPredicted intracellular proteins |
Annotation confidence score; open for threshold definitions.
Extremely high >= 0.70High >= 0.60Medium >= 0.40Low >= 0.30Basic Information
Protein Names
Cadherin-13 (Heart cadherin) (H-cadherin) (P105) (Truncated cadherin) (T-cad) (T-cadherin)
Protein Class (2)
Plasma proteinsPredicted intracellular proteins
Protein Function
Predicted intracellular proteins
Ensembl
Entrez Gene Symbol
Gene Synonym
CDHH
Gene Description
Cadherin 13
Chromosome
16
Position
82626965-83800640
Supporting publications (n)
1
EVMP confidence score
0.53
Function & Pathway
Protein Function
Predicted intracellular proteins
Cellular Component (14)
- GO:0005576 extracellular region
- GO:0005615 extracellular space
- GO:0005737 cytoplasm
- GO:0005886 plasma membrane
- GO:0005901 caveola
- GO:0005912 adherens junction
- GO:0005925 focal adhesion
- GO:0009897 external side of plasma membrane
- GO:0016342 catenin complex
- GO:0043005 neuron projection
Page 1 of 2
Molecular Function (8)
Biological Process (3)
Reactome (3)
Mediation Categories (3)
Adhesion and uptake mediationFusion and delivery mediationReceptor-signaling mediation
Relations & Evidence35
Ligand-Receptor Signaling (33)
33 records.
| Category | Parent | Database | Transmitter | Receiver | Secreted | Plasma Membrane (Transmembrane) | Plasma Membrane (Peripheral) |
|---|---|---|---|---|---|---|---|
| cell_surface | cell_surface | Baccin2019 | Yes | ||||
| cell_surface | cell_surface | OmniPath | Yes | ||||
| receptor | receptor | CellCellInteractions | Yes | Yes |
Page 4 of 4Previous
Regulatory Interaction Network (1)
1 record.
| Source Protein Symbol | Source UniProt ID | Target Protein Symbol | Target UniProt ID | Is Directed | Is Stimulation | Is Inhibition | Database | References |
|---|---|---|---|---|---|---|---|---|
| CAD13 | P55290 | CTNB1 | P35222 | Yes | Yes | SIGNOR | SIGNOR:21255999 |
Sequence, Structure & Domains
Sequences
Length
713
Mass
78,287
Sequence
MQPRTPLVLCVLLSQVLLLTSAEDLDCTPGFQQKVFHINQPAEFIEDQSILNLTFSDCKGNDKLRYEVSSPYFKVNSDGGLVALRNITAVGKTLFVHARTPHAEDMAELVIVGGKDIQGSLQDIFKFARTSPVPRQKRSIVVSPILIPENQRQPFPRDVGKVVDSDRPERSKFRLTGKGVDQEPKGIFRINENTGSVSVTRTLDREVIAVYQLFVETTDVNGKTLEGPVPLEVIVIDQNDNRPIFREGPYIGHVMEGSPTGTTVMRMTAFDADDPATDNALLRYNIRQQTPDKPSPNMFYIDPEKGDIVTVVSPALLDRETLENPKYELIIEAQDMAGLDVGLTGTATATIMIDDKNDHSPKFTKKEFQATVEEGAVGVIVNLTVEDKDDPTTGAWRAAYTIINGNPGQSFEIHTNPQTNEGMLSVVKPLDYEISAFHTLLIKVENEDPLVPDVSYGPSSTATVHITVLDVNEGPVFYPDPMMVTRQEDLSVGSVLLTVNATDPDSLQHQTIRYSVYKDPAGWLNINPINGTVDTTAVLDRESPFVDNSVYTALFLAIDSGNPPATGTGTLLITLEDVNDNAPFIYPTVAEVCDDAKNLSVVILGASDKDLHPNTDPFKFEIHKQAVPDKVWKISKINNTHALVSLLQNLNKANYNLPIMVTDSGKPPMTNITDLRVQVCSCRNSKVDCNAAGALRFSLPSVLLLSLFSLACL
Alternative Products
Event=Alternative splicing; Named isoforms=5; Name=1; IsoId=P55290-1; Sequence=Displayed; Name=2; IsoId=P55290-2; Sequence=VSP_042696, VSP_042697; Name=3; IsoId=P55290-3; Sequence=VSP_042794, VSP_042795; Name=4; IsoId=P55290-4; Sequence=VSP_046714; Name=5; IsoId=P55290-5; Sequence=VSP_053739
Alternative Sequence
1..14; MQPRTPLVLCVLLS -> MKTPPGASSRTKCSRELRSFCAFSCPRAKQPTCTAWFPQQEHPSENGPQMPGRDPPAASTM (in isoform 4); 123..161; Missing (in isoform 5); 162..190; VVDSDRPERSKFRLTGKGVDQEPKGIFRI -> RTHNPINSELLLNEGITADLNPCITILAI (in isoform 2); 162..175; VVDSDRPERSKFRL -> MKIWQVLCLARWLT (in isoform 3); 176..713; Missing (in isoform 3); 191..713; Missing (in isoform 2)
3D Structural Models
Turn
179..181; 192..194; 205..207
Beta Strand
145..148; 157..161; 163..167; 172..178; 182..184; 187..190; 196..199; 209..218; 224..236; 238..241
3D Structure
NMR spectroscopy (1)
Domain & Motif Annotations
Domain (CC)
Three calcium ions are usually bound at the interface of each cadherin domain and rigidify the connections, imparting a strong curvature to the full-length ectodomain.
Domain (FT)
139..245; Cadherin 1; 246..363; Cadherin 2; 364..477; Cadherin 3; 478..585; Cadherin 4; 584..694; Cadherin 5
Clinical Relevance
Supporting Publications1
| PMID | Title | Related sentences |
|---|---|---|
| 30646616 | Preferential Localization of MUC1 Glycoprotein in Exosomes Secreted by Non-Small Cell Lung Carcinoma Cells. | THBS1, ANXA6, HIST1H4A, COL18A1, MDK, SRGN, ENO1, TUBA4A, SLC3A2, GPI, MIF, MUC1, TALDO1, SLC7A5, ICAM1, HSP90AA1, G6PD, and LRP1 were found to be expressed in exosomes at more than 5-fold higher level as compared to total cellular membrane proteins. |