Protein detail
JAM2
Junctional adhesion molecule B (JAM-B) (Junctional adhesion molecule 2) (JAM-2) (Vascular endothelial junction-associated molecule) (VE-JAM) (CD antigen CD322)
Entry name JAM2 | UniProt ID | EVMP confidence score 0.63 |
Supporting publications (n) 6 | Transmembrane count 1 | Protein classification |
Annotation confidence score; open for threshold definitions.
Extremely high >= 0.70High >= 0.60Medium >= 0.40Low >= 0.30Basic Information
Protein Names
Junctional adhesion molecule B (JAM-B) (Junctional adhesion molecule 2) (JAM-2) (Vascular endothelial junction-associated molecule) (VE-JAM) (CD antigen CD322)
Protein Function (3)
- Human disease related genes:Nervous system diseases:Neurodegenerative diseases
- Disease related genes
- CD markers
Transmembrane
239..259; Helical
Transmembrane Count
1
Ensembl
Entrez Gene Symbol
Supporting publications (n)
6
EVMP confidence score
0.63
Fluorescence & Localization
Cell SpecificCardiomyocytes
Function & Pathway
Protein Function (3)
- Human disease related genes:Nervous system diseases:Neurodegenerative diseases
- Disease related genes
- CD markers
Cellular Component (7)
Molecular Function (2)
Biological Process (3)
KEGG (5)
Reactome (4)
Canonical Pathways (3)
- M290 Pid il12 stat4 pathway
- M88 Pid cd8 tcr pathway
- M34 Pid tcr pathway
Mediation Categories (2)
Fusion and delivery mediationImmune mediation
Relations & Evidence43
Ligand-Receptor Signaling (41)
41 records.
| Category | Parent | Database | Transmitter | Receiver | Secreted | Plasma Membrane (Transmembrane) | Plasma Membrane (Peripheral) |
|---|---|---|---|---|---|---|---|
| adhesion | adhesion | HGNC | Yes | Yes | Yes | ||
| cell_adhesion | cell_adhesion | Cellinker | Yes | Yes | Yes | ||
| cell_adhesion | cell_adhesion | HGNC | Yes | Yes | Yes | ||
| adhesion | adhesion | OmniPath | Yes | Yes | Yes | ||
| cell_adhesion | cell_adhesion | OmniPath | Yes | Yes | Yes | ||
| tight_junction | tight_junction | GO_Intercell | Yes | Yes | Yes | ||
| tight_junction | tight_junction | Zhong2015 | Yes | Yes | Yes | ||
| tight_junction | tight_junction | OmniPath | Yes | Yes | Yes | ||
| transmembrane | transmembrane | UniProt_location | Yes | ||||
| transmembrane | transmembrane | UniProt_topology | Yes |
Protein Complex Composition (1)
Sequence, Structure & Domains
Sequences
Length
298
Mass
33,207
Sequence
MARRSRHRLLLLLLRYLVVALGYHKAYGFSAPKDQQVVTAVEYQEAILACKTPKKTVSSRLEWKKLGRSVSFVYYQQTLQGDFKNRAEMIDFNIRIKNVTRSDAGKYRCEVSAPSEQGQNLEEDTVTLEVLVAPAVPSCEVPSSALSGTVVELRCQDKEGNPAPEYTWFKDGIRLLENPRLGSQSTNSSYTMNTKTGTLQFNTVSKLDTGEYSCEARNSVGYRRCPGKRMQVDDLNISGIIAAVVVVALVISVCGLGVCYAQRKGYFSKETSFQKSNSSSKATTMSENDFKHTKSFII
Alternative Products
Event=Alternative splicing; Named isoforms=3; Name=1; IsoId=P57087-1; Sequence=Displayed; Name=2; IsoId=P57087-2; Sequence=VSP_045153; Name=3; IsoId=P57087-3; Sequence=VSP_047352
Alternative Sequence
44..79; Missing (in isoform 2); 289..298; DFKHTKSFII -> VQWLTPVIPALWKAAAGGSRGQEF (in isoform 3)
Domain & Motif Annotations
Domain (CC)
The Ig-like V-type domain is necessary and sufficient to mediate interaction with JAM3 and integrin alpha-4/beta-1..
Domain (FT)
32..127; Ig-like V-type; 134..238; Ig-like C2-type
Protein Families
Immunoglobulin superfamily
Sequence Similarities
Belongs to the immunoglobulin superfamily.
Supporting Publications6
| PMID | Title | Related sentences |
|---|---|---|
| 32854315 | Proteomic Profiling of Extracellular Vesicles Derived from Cerebrospinal Fluid of Alzheimer's Disease Patients: A Pilot Study. | Recent studies have highlighted the importance of Aβ and tau-containing extracellular vesicles (EVs) in AD. |
| 38207106 | Proteomic, Metabolomic, and Fatty Acid Profiling of Small Extracellular Vesicles from Glioblastoma Stem-Like Cells and Their Role in Tumor Heterogeneity. | No related sentences available |
| 40189497 | Small extracellular vesicle-based one-step high-throughput microfluidic platform for epithelial ovarian cancer diagnosis. | No related sentences available |
| 40730843 | Single urinary extracellular vesicle proteomics identifies complement receptor CD35 as a biomarker for sepsis-associated acute kidney injury. | No related sentences available |
| 40985879 | TurboID-Mediated Profiling of Glioblastoma-Derived Extracellular Vesicle Cargo Proteins. | No related sentences available |
| 41068253 | Identification of plasma extracellular vesicle protein biomarkers in diabetic retinopathy progression. | No related sentences available |