Protein detail
DEST
Destrin (Actin-depolymerizing factor) (ADF)
Entry name DEST | UniProt ID | EVMP confidence score 0.75 |
Supporting publications (n) 30 | Transmembrane count | Protein classification Plasma proteinsPredicted intracellular proteins |
EVMP confidence score
Annotation confidence score; open for threshold definitions.
Extremely high >= 0.85High >= 0.70Medium >= 0.55Low >= 0.40Basic Information11
Protein Names
Destrin (Actin-depolymerizing factor) (ADF)
Protein Class (2)
Plasma proteinsPredicted intracellular proteins
Protein Function
Predicted intracellular proteins
Ensembl
Entrez Gene Symbol
Gene Synonym (2)
ACTDPADF
Gene Description
Destrin, actin depolymerizing factor
Chromosome
20
Position
17570075-17609919
Supporting publications (n)
30
EVMP confidence score
0.75
Fluorescence & Localization3
Tissue SpecificbrainCell SpecificDifferentiating spermatogoniaBlood Cell SpecificT-reg
Function & Pathway5
Protein Function
Predicted intracellular proteins
Cellular Component (7)
Molecular Function (2)
Biological Process (3)
Mediation Categories
Fusion and delivery mediation
Relations & Evidence16
Enzyme-Mediated Modification (5)
5 records.
| Substrate Gene Symbol | Enzyme Gene Symbol | Enzyme UniProt ID | Residue Type | Residue Offset | Modification | Database | References |
|---|---|---|---|---|---|---|---|
| DSTN | TESK2 | Q96S53 | S | 3 | phosphorylation | PhosphoSite_MIMPMIMPHPRD_MIMPProtMapperHPRDKEASIGNOR_ProtMapper | HPRD:19413330HPRD:11418599HPRD:19651622ProtMapper:11418599HPRD:20068231KEA:11418599 |
| DSTN | SSH1 | Q8WYL5 | S | 3 | dephosphorylation | DEPOD | DEPOD:11832213 |
| DSTN | LIMK2 | P53671 | S | 3 | phosphorylation | PhosphoSite_MIMPMIMPHPRD_MIMPProtMapperPhosphoSitePhosphoSite_ProtMapper | |
| DSTN | LIMK1 | P53667 | S | 3 | phosphorylation | PhosphoSite_MIMPMIMPHPRD_MIMPProtMapperPhosphoSitePhosphoSite_ProtMapper | |
| DSTN | TESK1 | Q15569 | S | 3 | phosphorylation | PhosphoSite |
Ligand-Receptor Signaling (3)
3 records.
| Category | Parent | Database | Transmitter | Receiver | Secreted | Plasma Membrane (Transmembrane) | Plasma Membrane (Peripheral) |
|---|---|---|---|---|---|---|---|
| intracellular | intracellular | ComPPI | No | No | No | No | No |
| intracellular | intracellular | GO_Intercell | No | No | No | No | No |
| intracellular | intracellular | OmniPath | No | No | No | No | No |
Regulatory Interaction Network (2)
2 records.
| Source Protein Symbol | Source UniProt ID | Target Protein Symbol | Target UniProt ID | Is Directed | Is Stimulation | Is Inhibition | Database | References |
|---|---|---|---|---|---|---|---|---|
| TESK2 | Q96S53 | DEST | P60981 | Yes | No | Yes | PhosphoSite_MIMPMIMPHPRD_MIMPiPTMnetPhosphoPointSIGNORProtMapperHPRDKEAHPRD_KEASIGNOR_ProtMapperHPRD-phos | HPRD:11418599HPRD-phos:11418599ProtMapper:11418599ProtMapper:19651622ProtMapper:20068231HPRD-phos:20068231KEA:11418599HPRD-phos:19413330SIGNOR:11418599HPRD-phos:19651622ProtMapper:19413330 |
| LIMK2 | P53671 | DEST | P60981 | Yes | No | No | PhosphoSite_MIMPMIMPHPRD_MIMPiPTMnetProtMapperACSNPhosphoSitePhosphoSite_ProtMapper | ACSN:11340065PhosphoSite:7615564ACSN:10613909ACSN:10559936ACSN:11950587ACSN:11413130ACSN:10461188 |
Protein Complex Composition (5)
5 records.
| Component Name | Component Gene Symbols | Component UniProt ID | Stoichiometry | Database | Database IDs | References |
|---|---|---|---|---|---|---|
| COX17DSTNHAAOPIN1 | P46952P60981Q13526Q14061 | 0:0:0:0 | hu.MAP2 | |||
| DSTNGCNT4PCBD1TSTD1 | P60981P61457Q8NFU3Q9P109 | 0:0:0:0 | hu.MAP2 | |||
| CROTDPP3DSTNLIMD1MDP1MYG1NMIOTULINPIEZO1 | P60981Q13287Q86V88Q92508Q96BN8Q9HB07Q9NY33Q9UGP4Q9UKG9 | 0:0:0:0:0:0:0:0:0 | Havugimana2012 | Havugimana2012:C_568 | ||
| COX17DSTN | P60981Q14061 | 0:0 | hu.MAP2 | |||
| ADSS1DSTN | P60981Q8N142 | 0:0 | hu.MAP2 |
Isolation & Detection Technology (1)
1 record.
| EV Isolation Method | Detection Method | Number of References | References |
|---|---|---|---|
| Size Exclusion Chromatography | Mass spectrometry | 1 | 31414377 |
Sequence, Structure & Domains9
Sequences
Length
165
Mass
18,506
Sequence
MASGVQVADEVCRIFYDMKVRKCSTPEEIKKRKKAVIFCLSADKKCIIVEEGKEILVGDVGVTITDPFKHFVGMLPEKDCRYALYDASFETKESRKEELMFFLWAPELAPLKSKMIYASSKDAIKKKFQGIKHECQANGPEDLNRACIAEKLGGSLIVAFEGCPV
Alternative Products
Event=Alternative splicing; Named isoforms=2; Name=1; IsoId=P60981-1; Sequence=Displayed; Name=2; IsoId=P60981-2; Sequence=VSP_043069
Alternative Sequence
1..17; Missing (in isoform 2)
Domain & Motif Annotations
Motif
30..34; Nuclear localization signal
Domain (FT)
4..153; ADF-H
Protein Families
Actin-binding proteins ADF family
Sequence Similarities
Belongs to the actin-binding proteins ADF family.
Clinical Relevance4
Supporting Publications30
| PMID | Title | Abstract |
|---|---|---|
| 26826536 | [Cardiovascular risk study in patients with renin-angiotensin system blockade by means of the proteone of circulating extracellular vesicles]. | No abstract available |
| 30178811 | Effect of exercise on the plasma vesicular proteome: a methodological study comparing acoustic trapping and centrifugation. | No abstract available |
| 31805958 | Proteomic analysis of cerebrospinal fluid extracellular vesicles reveals synaptic injury, inflammation, and stress response markers in HIV patients with cognitive impairment. | No abstract available |
| 32230970 | Radiation Exposure of Peripheral Mononuclear Blood Cells Alters the Composition and Function of Secreted Extracellular Vesicles. | No abstract available |
| 32560723 | T2 and T17 cytokines alter the cargo and function of airway epithelium-derived extracellular vesicles. | No abstract available |
| 32854315 | Proteomic Profiling of Extracellular Vesicles Derived from Cerebrospinal Fluid of Alzheimer's Disease Patients: A Pilot Study. | Recent studies have highlighted the importance of Aβ and tau-containing extracellular vesicles (EVs) in AD. |
| 32916986 | Proteomic Approach for Searching for Universal, Tissue-Specific, and Line-Specific Markers of Extracellular Vesicles in Lung and Colorectal Adenocarcinoma Cell Lines. | No abstract available |
| 33304478 | The proteomic landscape of small urinary extracellular vesicles during kidney transplantation. | No abstract available |
| 33309826 | Proteomic analysis of extracellular vesicles and conditioned medium from human adipose-derived stem/stromal cells and dermal fibroblasts. | No abstract available |
| 33592500 | A Proteomic Approach to Understand the Clinical Significance of Acute Myeloid Leukemia-Derived Extracellular Vesicles Reflecting Essential Characteristics of Leukemia. | No abstract available |
Page 1 of 3Next