Protein detail
DEST
Destrin (Actin-depolymerizing factor) (ADF)
Entry name DEST | UniProt ID | EVMP confidence score 0.88 |
Supporting publications (n) 30 | Transmembrane count | Protein classification Plasma proteinsPredicted intracellular proteins |
Annotation confidence score; open for threshold definitions.
Extremely high >= 0.70High >= 0.60Medium >= 0.40Low >= 0.30Basic Information
Protein Names
Destrin (Actin-depolymerizing factor) (ADF)
Protein Class (2)
Plasma proteinsPredicted intracellular proteins
Protein Function
Predicted intracellular proteins
Ensembl
Entrez Gene Symbol
Gene Synonym (2)
ACTDPADF
Gene Description
Destrin, actin depolymerizing factor
Chromosome
20
Position
17570075-17609919
Supporting publications (n)
30
EVMP confidence score
0.88
Fluorescence & Localization
Tissue SpecificbrainCell SpecificDifferentiating spermatogoniaBlood Cell SpecificT-reg
Function & Pathway
Protein Function
Predicted intracellular proteins
Cellular Component (7)
Molecular Function (2)
Biological Process (3)
Mediation Categories
Fusion and delivery mediation
Relations & Evidence16
Enzyme-Mediated Modification (5)
5 records.
| Substrate Gene Symbol | Enzyme Gene Symbol | Enzyme UniProt ID | Residue Type | Residue Offset | Modification | Database | References |
|---|---|---|---|---|---|---|---|
| DSTN | TESK2 | Q96S53 | S | 3 | phosphorylation | PhosphoSite_MIMPMIMPHPRD_MIMPProtMapperHPRDKEASIGNOR_ProtMapper | HPRD:19413330HPRD:11418599HPRD:19651622ProtMapper:11418599HPRD:20068231KEA:11418599 |
| DSTN | SSH1 | Q8WYL5 | S | 3 | dephosphorylation | DEPOD | DEPOD:11832213 |
| DSTN | LIMK2 | P53671 | S | 3 | phosphorylation | PhosphoSite_MIMPMIMPHPRD_MIMPProtMapperPhosphoSitePhosphoSite_ProtMapper | |
| DSTN | LIMK1 | P53667 | S | 3 | phosphorylation | PhosphoSite_MIMPMIMPHPRD_MIMPProtMapperPhosphoSitePhosphoSite_ProtMapper | |
| DSTN | TESK1 | Q15569 | S | 3 | phosphorylation | PhosphoSite |
Ligand-Receptor Signaling (3)
3 records.
| Category | Parent | Database | Transmitter | Receiver | Secreted | Plasma Membrane (Transmembrane) | Plasma Membrane (Peripheral) |
|---|---|---|---|---|---|---|---|
| intracellular | intracellular | ComPPI | |||||
| intracellular | intracellular | GO_Intercell | |||||
| intracellular | intracellular | OmniPath |
Regulatory Interaction Network (2)
2 records.
| Source Protein Symbol | Source UniProt ID | Target Protein Symbol | Target UniProt ID | Is Directed | Is Stimulation | Is Inhibition | Database | References |
|---|---|---|---|---|---|---|---|---|
| TESK2 | Q96S53 | DEST | P60981 | Yes | Yes | PhosphoSite_MIMPMIMPHPRD_MIMPiPTMnetPhosphoPointSIGNORProtMapperHPRDKEAHPRD_KEASIGNOR_ProtMapperHPRD-phos | HPRD:11418599HPRD-phos:11418599ProtMapper:11418599ProtMapper:19651622ProtMapper:20068231HPRD-phos:20068231KEA:11418599HPRD-phos:19413330SIGNOR:11418599HPRD-phos:19651622ProtMapper:19413330 | |
| LIMK2 | P53671 | DEST | P60981 | Yes | PhosphoSite_MIMPMIMPHPRD_MIMPiPTMnetProtMapperACSNPhosphoSitePhosphoSite_ProtMapper | ACSN:11340065PhosphoSite:7615564ACSN:10613909ACSN:10559936ACSN:11950587ACSN:11413130ACSN:10461188 |
Protein Complex Composition (5)
5 records.
| Component Name | Component Gene Symbols | Component UniProt ID | Stoichiometry | Database | Database IDs | References |
|---|---|---|---|---|---|---|
| COX17DSTNHAAOPIN1 | P46952P60981Q13526Q14061 | 0:0:0:0 | hu.MAP2 | |||
| DSTNGCNT4PCBD1TSTD1 | P60981P61457Q8NFU3Q9P109 | 0:0:0:0 | hu.MAP2 | |||
| CROTDPP3DSTNLIMD1MDP1MYG1NMIOTULINPIEZO1 | P60981Q13287Q86V88Q92508Q96BN8Q9HB07Q9NY33Q9UGP4Q9UKG9 | 0:0:0:0:0:0:0:0:0 | Havugimana2012 | Havugimana2012:C_568 | ||
| COX17DSTN | P60981Q14061 | 0:0 | hu.MAP2 | |||
| ADSS1DSTN | P60981Q8N142 | 0:0 | hu.MAP2 |
Isolation & Detection Technology (1)
1 record.
| EV Isolation Method | Detection Method | Number of References | References |
|---|---|---|---|
| Size Exclusion Chromatography | Mass spectrometry | 1 | 31414377 |
Sequence, Structure & Domains
Sequences
Length
165
Mass
18,506
Sequence
MASGVQVADEVCRIFYDMKVRKCSTPEEIKKRKKAVIFCLSADKKCIIVEEGKEILVGDVGVTITDPFKHFVGMLPEKDCRYALYDASFETKESRKEELMFFLWAPELAPLKSKMIYASSKDAIKKKFQGIKHECQANGPEDLNRACIAEKLGGSLIVAFEGCPV
Alternative Products
Event=Alternative splicing; Named isoforms=2; Name=1; IsoId=P60981-1; Sequence=Displayed; Name=2; IsoId=P60981-2; Sequence=VSP_043069
Alternative Sequence
1..17; Missing (in isoform 2)
Domain & Motif Annotations
Motif
30..34; Nuclear localization signal
Domain (FT)
4..153; ADF-H
Protein Families
Actin-binding proteins ADF family
Sequence Similarities
Belongs to the actin-binding proteins ADF family.
Clinical Relevance
Supporting Publications30
| PMID | Title | Related sentences |
|---|---|---|
| 34064677 | Ubiquinone Metabolism and Transcription HIF-1 Targets Pathway Are Toxicity Signature Pathways Present in Extracellular Vesicles of Paraquat-Exposed Human Brain Microvascular Endothelial Cells. | No related sentences available |
| 34473505 | Column-based Technology for CD9-HPLC Immunoaffinity Isolation of Serum Extracellular Vesicles. | Column-based Technology for CD9-HPLC Immunoaffinity Isolation of Serum Extracellular Vesicles. |
| 34576246 | Burn Injury Induces Proinflammatory Plasma Extracellular Vesicles That Associate with Length of Hospital Stay in Women: CRP and SAA1 as Potential Prognostic Indicators. | No related sentences available |
| 36064647 | Systemic proteomics and miRNA profile analysis of exosomes derived from human pluripotent stem cells. | No related sentences available |
| 36146834 | Human Cytomegalovirus Modifies Placental Small Extracellular Vesicle Composition to Enhance Infection of Fetal Neural Cells In Vitro. | No related sentences available |
| 36497184 | Oxidative Stress and Extracellular Matrix Remodeling Are Signature Pathways of Extracellular Vesicles Released upon Morphine Exposure on Human Brain Microvascular Endothelial Cells. | No related sentences available |
| 37204515 | Proteomic profiling and functional characterization of serum-derived extracellular vesicles in the mucinous and non-mucinous colon adenocarcinoma. | No related sentences available |
| 37322475 | Comprehensive profiling of extracellular vesicles in uveitis and scleritis enables biomarker discovery and mechanism exploration. | No related sentences available |
| 37438638 | Extracellular Vesicles Play a Central Role in Cerebral Venous Disease-Associated Brain Atrophy. | No related sentences available |
| 37926756 | Extracellular vesicles from non-neuroendocrine SCLC cells promote adhesion and survival of neuroendocrine SCLC cells. | No related sentences available |