Protein detail

DEST

Destrin (Actin-depolymerizing factor) (ADF)

Entry name DEST	UniProt ID P60981	EVMP confidence score 0.75
Supporting publications (n) 30	Transmembrane count	Protein classification Plasma proteinsPredicted intracellular proteins

EVMP confidence score

Annotation confidence score; open for threshold definitions.

Extremely high >= 0.85High >= 0.70Medium >= 0.55Low >= 0.40

Basic Information11

Protein Names

Destrin (Actin-depolymerizing factor) (ADF)

Protein Class (2)

Plasma proteinsPredicted intracellular proteins

Protein Function

Predicted intracellular proteins

Ensembl

ENSG00000125868

Entrez Gene Symbol

DSTN

Gene Synonym (2)

ACTDPADF

Gene Description

Destrin, actin depolymerizing factor

Chromosome

Position

17570075-17609919

Supporting publications (n)

EVMP confidence score

0.75

Fluorescence & Localization3

Tissue SpecificbrainCell SpecificDifferentiating spermatogoniaBlood Cell SpecificT-reg

Function & Pathway5

Protein Function

Predicted intracellular proteins

Cellular Component (7)

Molecular Function (2)

Biological Process (3)

Mediation Categories

Fusion and delivery mediation

Relations & Evidence16

Enzyme-Mediated Modification (5)

5 records.

Substrate Gene Symbol	Enzyme Gene Symbol	Enzyme UniProt ID	Residue Type	Residue Offset	Modification	Database	References
DSTN	TESK2	Q96S53	S	3	phosphorylation	PhosphoSite_MIMPMIMPHPRD_MIMPProtMapperHPRDKEASIGNOR_ProtMapper	HPRD:19413330 HPRD:11418599 HPRD:19651622 ProtMapper:11418599 HPRD:20068231 KEA:11418599
DSTN	SSH1	Q8WYL5	S	3	dephosphorylation	DEPOD	DEPOD:11832213
DSTN	LIMK2	P53671	S	3	phosphorylation	PhosphoSite_MIMPMIMPHPRD_MIMPProtMapperPhosphoSitePhosphoSite_ProtMapper
DSTN	LIMK1	P53667	S	3	phosphorylation	PhosphoSite_MIMPMIMPHPRD_MIMPProtMapperPhosphoSitePhosphoSite_ProtMapper
DSTN	TESK1	Q15569	S	3	phosphorylation	PhosphoSite

Ligand-Receptor Signaling (3)

3 records.

Category	Parent	Database	Transmitter	Receiver	Secreted	Plasma Membrane (Transmembrane)	Plasma Membrane (Peripheral)
intracellular	intracellular	ComPPI	No	No	No	No	No
intracellular	intracellular	GO_Intercell	No	No	No	No	No
intracellular	intracellular	OmniPath	No	No	No	No	No

Regulatory Interaction Network (2)

2 records.

Source Protein Symbol	Source UniProt ID	Target Protein Symbol	Target UniProt ID	Is Directed	Is Stimulation	Is Inhibition	Database	References
TESK2	Q96S53	DEST	P60981	Yes	No	Yes	PhosphoSite_MIMPMIMPHPRD_MIMPiPTMnetPhosphoPointSIGNORProtMapperHPRDKEAHPRD_KEASIGNOR_ProtMapperHPRD-phos	HPRD:11418599 HPRD-phos:11418599 ProtMapper:11418599 ProtMapper:19651622 ProtMapper:20068231 HPRD-phos:20068231 KEA:11418599 HPRD-phos:19413330 SIGNOR:11418599 HPRD-phos:19651622 ProtMapper:19413330
LIMK2	P53671	DEST	P60981	Yes	No	No	PhosphoSite_MIMPMIMPHPRD_MIMPiPTMnetProtMapperACSNPhosphoSitePhosphoSite_ProtMapper	ACSN:11340065 PhosphoSite:7615564 ACSN:10613909 ACSN:10559936 ACSN:11950587 ACSN:11413130 ACSN:10461188

Protein Complex Composition (5)

5 records.

Component Gene Symbols	Component UniProt ID	Stoichiometry	Database	Database IDs
COX17 DSTN HAAO PIN1	P46952 P60981 Q13526 Q14061	0:0:0:0	hu.MAP2
DSTN GCNT4 PCBD1 TSTD1	P60981 P61457 Q8NFU3 Q9P109	0:0:0:0	hu.MAP2
CROT DPP3 DSTN LIMD1 MDP1 MYG1 NMI OTULIN PIEZO1	P60981 Q13287 Q86V88 Q92508 Q96BN8 Q9HB07 Q9NY33 Q9UGP4 Q9UKG9	0:0:0:0:0:0:0:0:0	Havugimana2012	Havugimana2012:C_568
COX17 DSTN	P60981 Q14061	0:0	hu.MAP2
ADSS1 DSTN	P60981 Q8N142	0:0	hu.MAP2

Isolation & Detection Technology (1)

1 record.

EV Isolation Method	Detection Method	Number of References	References
Size Exclusion Chromatography	Mass spectrometry	1	31414377

Sequence, Structure & Domains9

Sequences

Length

165

Mass

18,506

Sequence

MASGVQVADEVCRIFYDMKVRKCSTPEEIKKRKKAVIFCLSADKKCIIVEEGKEILVGDVGVTITDPFKHFVGMLPEKDCRYALYDASFETKESRKEELMFFLWAPELAPLKSKMIYASSKDAIKKKFQGIKHECQANGPEDLNRACIAEKLGGSLIVAFEGCPV

Alternative Products

Event=Alternative splicing; Named isoforms=2; Name=1; IsoId=P60981-1; Sequence=Displayed; Name=2; IsoId=P60981-2; Sequence=VSP_043069

Alternative Sequence

1..17; Missing (in isoform 2)

Domain & Motif Annotations

Motif

30..34; Nuclear localization signal

Domain (FT)

4..153; ADF-H

Protein Families

Actin-binding proteins ADF family

Sequence Similarities

Belongs to the actin-binding proteins ADF family.

Clinical Relevance4

Antibody (2)

CAB037094 HPA077782

Interaction Protein (4)

ENSG00000001626ENSG00000075624ENSG00000165410ENSG00000184009

Interaction Count

Interaction Dataset (2)

intact_biogridintact_biogrid_opencell

Supporting Publications30

PMID	Title	Abstract
34064677	Ubiquinone Metabolism and Transcription HIF-1 Targets Pathway Are Toxicity Signature Pathways Present in Extracellular Vesicles of Paraquat-Exposed Human Brain Microvascular Endothelial Cells.	No abstract available
34473505	Column-based Technology for CD9-HPLC Immunoaffinity Isolation of Serum Extracellular Vesicles.	No abstract available
34576246	Burn Injury Induces Proinflammatory Plasma Extracellular Vesicles That Associate with Length of Hospital Stay in Women: CRP and SAA1 as Potential Prognostic Indicators.	No abstract available
36064647	Systemic proteomics and miRNA profile analysis of exosomes derived from human pluripotent stem cells.	No abstract available
36146834	Human Cytomegalovirus Modifies Placental Small Extracellular Vesicle Composition to Enhance Infection of Fetal Neural Cells In Vitro.	No abstract available
36497184	Oxidative Stress and Extracellular Matrix Remodeling Are Signature Pathways of Extracellular Vesicles Released upon Morphine Exposure on Human Brain Microvascular Endothelial Cells.	No abstract available
37204515	Proteomic profiling and functional characterization of serum-derived extracellular vesicles in the mucinous and non-mucinous colon adenocarcinoma.	No abstract available
37322475	Comprehensive profiling of extracellular vesicles in uveitis and scleritis enables biomarker discovery and mechanism exploration.	No abstract available
37438638	Extracellular Vesicles Play a Central Role in Cerebral Venous Disease-Associated Brain Atrophy.	No abstract available
37926756	Extracellular vesicles from non-neuroendocrine SCLC cells promote adhesion and survival of neuroendocrine SCLC cells.	No abstract available

Page 2 of 3Previous Next