Protein detail

DEST

Destrin (Actin-depolymerizing factor) (ADF)

Entry name DEST	UniProt ID P60981	EVMP confidence score 0.75
Supporting publications (n) 30	Transmembrane count	Protein classification Plasma proteinsPredicted intracellular proteins

EVMP confidence score

Annotation confidence score; open for threshold definitions.

Extremely high >= 0.85High >= 0.70Medium >= 0.55Low >= 0.40

Basic Information11

Protein Names

Destrin (Actin-depolymerizing factor) (ADF)

Protein Class (2)

Plasma proteinsPredicted intracellular proteins

Protein Function

Predicted intracellular proteins

Ensembl

ENSG00000125868

Entrez Gene Symbol

DSTN

Gene Synonym (2)

ACTDPADF

Gene Description

Destrin, actin depolymerizing factor

Chromosome

Position

17570075-17609919

Supporting publications (n)

EVMP confidence score

0.75

Fluorescence & Localization3

Tissue SpecificbrainCell SpecificDifferentiating spermatogoniaBlood Cell SpecificT-reg

Function & Pathway5

Protein Function

Predicted intracellular proteins

Cellular Component (7)

Molecular Function (2)

Biological Process (3)

Mediation Categories

Fusion and delivery mediation

Relations & Evidence16

Enzyme-Mediated Modification (5)

5 records.

Substrate Gene Symbol	Enzyme Gene Symbol	Enzyme UniProt ID	Residue Type	Residue Offset	Modification	Database	References
DSTN	TESK2	Q96S53	S	3	phosphorylation	PhosphoSite_MIMPMIMPHPRD_MIMPProtMapperHPRDKEASIGNOR_ProtMapper	HPRD:19413330 HPRD:11418599 HPRD:19651622 ProtMapper:11418599 HPRD:20068231 KEA:11418599
DSTN	SSH1	Q8WYL5	S	3	dephosphorylation	DEPOD	DEPOD:11832213
DSTN	LIMK2	P53671	S	3	phosphorylation	PhosphoSite_MIMPMIMPHPRD_MIMPProtMapperPhosphoSitePhosphoSite_ProtMapper
DSTN	LIMK1	P53667	S	3	phosphorylation	PhosphoSite_MIMPMIMPHPRD_MIMPProtMapperPhosphoSitePhosphoSite_ProtMapper
DSTN	TESK1	Q15569	S	3	phosphorylation	PhosphoSite

Ligand-Receptor Signaling (3)

3 records.

Category	Parent	Database	Transmitter	Receiver	Secreted	Plasma Membrane (Transmembrane)	Plasma Membrane (Peripheral)
intracellular	intracellular	ComPPI	No	No	No	No	No
intracellular	intracellular	GO_Intercell	No	No	No	No	No
intracellular	intracellular	OmniPath	No	No	No	No	No

Regulatory Interaction Network (2)

2 records.

Source Protein Symbol	Source UniProt ID	Target Protein Symbol	Target UniProt ID	Is Directed	Is Stimulation	Is Inhibition	Database	References
TESK2	Q96S53	DEST	P60981	Yes	No	Yes	PhosphoSite_MIMPMIMPHPRD_MIMPiPTMnetPhosphoPointSIGNORProtMapperHPRDKEAHPRD_KEASIGNOR_ProtMapperHPRD-phos	HPRD:11418599 HPRD-phos:11418599 ProtMapper:11418599 ProtMapper:19651622 ProtMapper:20068231 HPRD-phos:20068231 KEA:11418599 HPRD-phos:19413330 SIGNOR:11418599 HPRD-phos:19651622 ProtMapper:19413330
LIMK2	P53671	DEST	P60981	Yes	No	No	PhosphoSite_MIMPMIMPHPRD_MIMPiPTMnetProtMapperACSNPhosphoSitePhosphoSite_ProtMapper	ACSN:11340065 PhosphoSite:7615564 ACSN:10613909 ACSN:10559936 ACSN:11950587 ACSN:11413130 ACSN:10461188

Protein Complex Composition (5)

5 records.

Component Gene Symbols	Component UniProt ID	Stoichiometry	Database	Database IDs
COX17 DSTN HAAO PIN1	P46952 P60981 Q13526 Q14061	0:0:0:0	hu.MAP2
DSTN GCNT4 PCBD1 TSTD1	P60981 P61457 Q8NFU3 Q9P109	0:0:0:0	hu.MAP2
CROT DPP3 DSTN LIMD1 MDP1 MYG1 NMI OTULIN PIEZO1	P60981 Q13287 Q86V88 Q92508 Q96BN8 Q9HB07 Q9NY33 Q9UGP4 Q9UKG9	0:0:0:0:0:0:0:0:0	Havugimana2012	Havugimana2012:C_568
COX17 DSTN	P60981 Q14061	0:0	hu.MAP2
ADSS1 DSTN	P60981 Q8N142	0:0	hu.MAP2

Isolation & Detection Technology (1)

1 record.

EV Isolation Method	Detection Method	Number of References	References
Size Exclusion Chromatography	Mass spectrometry	1	31414377

Sequence, Structure & Domains9

Sequences

Length

165

Mass

18,506

Sequence

MASGVQVADEVCRIFYDMKVRKCSTPEEIKKRKKAVIFCLSADKKCIIVEEGKEILVGDVGVTITDPFKHFVGMLPEKDCRYALYDASFETKESRKEELMFFLWAPELAPLKSKMIYASSKDAIKKKFQGIKHECQANGPEDLNRACIAEKLGGSLIVAFEGCPV

Alternative Products

Event=Alternative splicing; Named isoforms=2; Name=1; IsoId=P60981-1; Sequence=Displayed; Name=2; IsoId=P60981-2; Sequence=VSP_043069

Alternative Sequence

1..17; Missing (in isoform 2)

Domain & Motif Annotations

Motif

30..34; Nuclear localization signal

Domain (FT)

4..153; ADF-H

Protein Families

Actin-binding proteins ADF family

Sequence Similarities

Belongs to the actin-binding proteins ADF family.

Clinical Relevance4

Antibody (2)

CAB037094 HPA077782

Interaction Protein (4)

ENSG00000001626ENSG00000075624ENSG00000165410ENSG00000184009

Interaction Count

Interaction Dataset (2)

intact_biogridintact_biogrid_opencell

Supporting Publications30

PMID	Title	Abstract
38113368	In-Depth Proteome Profiling of Small Extracellular Vesicles Isolated from Cancer Cell Lines and Patient Serum.	No abstract available
38207106	Proteomic, Metabolomic, and Fatty Acid Profiling of Small Extracellular Vesicles from Glioblastoma Stem-Like Cells and Their Role in Tumor Heterogeneity.	No abstract available
38396626	Protein Profiling of Placental Extracellular Vesicles in Gestational Diabetes Mellitus.	No abstract available
38891077	Altered Extracellular Vesicle-Derived Protein and microRNA Signatures in Bronchoalveolar Lavage Fluid from Patients with Chronic Obstructive Pulmonary Disease.	No abstract available
38917926	Small extracellular vesicle CA1 as a promising diagnostic biomarker for nasopharyngeal carcinoma.	No abstract available
39207047	The trajectory of vesicular proteomic signatures from HBV-HCC by chitosan-magnetic bead-based separation and DIA-proteomic analysis.	No abstract available
40465195	Extracellular vesicle proteomics uncovers energy metabolism, complement system, and endoplasmic reticulum stress response dysregulation postexercise in males with myalgic encephalomyelitis/chronic fatigue syndrome.	No abstract available
40985879	TurboID-Mediated Profiling of Glioblastoma-Derived Extracellular Vesicle Cargo Proteins.	No abstract available
41068253	Identification of plasma extracellular vesicle protein biomarkers in diabetic retinopathy progression.	No abstract available
41307968	Extracellular Vesicles Define Discrete Nano-Based Niches Within the Human Haematopoietic System.	No abstract available

Page 3 of 3Previous