Protein detail
B2MG
Beta-2-microglobulin [Cleaved into: Beta-2-microglobulin form pI 5.3]
Entry name B2MG | UniProt ID | EVMP confidence score 0.40 |
Supporting publications (n) 1 | Transmembrane count | Protein classification Cancer-related genesDisease related genesHuman disease related genesPlasma proteinsPotential drug targetsPredicted secreted proteinsTransporters |
Annotation confidence score; open for threshold definitions.
Extremely high >= 0.70High >= 0.60Medium >= 0.40Low >= 0.30Basic Information
Protein Names
Beta-2-microglobulin [Cleaved into: Beta-2-microglobulin form pI 5.3]
Protein Class (7)
Cancer-related genesDisease related genesHuman disease related genesPlasma proteinsPotential drug targetsPredicted secreted proteinsTransporters
Protein Function (10)
- Cancer-related genes:Mutational cancer driver genes
- Transporters
- Human disease related genes:Cardiovascular diseases:Hematologic diseases
- Human disease related genes:Nervous system diseases:Neurodegenerative diseases
- Cancer-related genes:Mutated cancer genes
- Potential drug targets
- Cancer-related genes:Candidate cancer biomarkers
- Human disease related genes:Cancers:Cancers of haematopoietic and lymphoid tissues
- Predicted secreted proteins
- Disease related genes
Ensembl
Entrez Gene Symbol
Gene Description
Beta-2-microglobulin
Chromosome
15
Position
44711358-44718851
Supporting publications (n)
1
EVMP confidence score
0.40
Fluorescence & Localization
Cell SpecificEsophageal apical cellsSingle-Nuclei Brain SpecificoligodendrocyteBlood Cell Specificintermediate monocyte
Function & Pathway
Protein Function (10)
- Cancer-related genes:Mutational cancer driver genes
- Transporters
- Human disease related genes:Cardiovascular diseases:Hematologic diseases
- Human disease related genes:Nervous system diseases:Neurodegenerative diseases
- Cancer-related genes:Mutated cancer genes
- Potential drug targets
- Cancer-related genes:Candidate cancer biomarkers
- Human disease related genes:Cancers:Cancers of haematopoietic and lymphoid tissues
- Predicted secreted proteins
- Disease related genes
Cellular Component (25)
- GO:0000139 Golgi membrane
- GO:0005576 extracellular region
- GO:0005615 extracellular space
- GO:0005765 lysosomal membrane
- GO:0005783 endoplasmic reticulum
- GO:0005788 endoplasmic reticulum lumen
- GO:0005794 Golgi apparatus
- GO:0005829 cytosol
- GO:0005886 plasma membrane
- GO:0005925 focal adhesion
Page 1 of 3
Molecular Function (6)
Biological Process (3)
KEGG (6)
Reactome (28)
- R-hsa-1280218 adaptive immune system
- R-hsa-977225 amyloid fiber formation
- R-hsa-983170 antigen presentation folding assembly and peptide loading of class i mhc
- R-hsa-1236975 antigen processing cross presentation
- R-hsa-9824439 bacterial infection pathways
- R-hsa-983169 class i mhc mediated antigen processing presentation
- R-hsa-1280215 cytokine signaling in immune system
- R-hsa-2172127 dap12 interactions
- R-hsa-2424491 dap12 signaling
- R-hsa-1236977 endosomal vacuolar pathway
Page 1 of 3
Mediation Categories (5)
Adhesion and uptake mediationClinical-translation mediationFusion and delivery mediationImmune mediationMetabolism mediation
Relations & Evidence108
Ligand-Receptor Signaling (17)
17 records.
| Category | Parent | Database | Transmitter | Receiver | Secreted | Plasma Membrane (Transmembrane) | Plasma Membrane (Peripheral) |
|---|---|---|---|---|---|---|---|
| ecm | ecm | GO_Intercell | Yes | Yes | |||
| ecm | ecm | OmniPath | Yes | Yes | |||
| extracellular | extracellular | DGIdb | Yes | ||||
| extracellular | extracellular | LOCATE | Yes | ||||
| extracellular | extracellular | OmniPath | Yes | ||||
| intracellular | intracellular | ComPPI | Yes | ||||
| intracellular | intracellular | GO_Intercell | Yes | ||||
| intracellular | intracellular | OmniPath | Yes | ||||
| cell_surface_ligand | cell_surface_ligand | CellPhoneDB | Yes | Yes | |||
| cell_surface_ligand | cell_surface_ligand | OmniPath | Yes | Yes |
Page 1 of 2Next
Protein Complex Composition (90)
90 records.
| Component Name | Component Gene Symbols | Component UniProt ID | Stoichiometry | Database | Database IDs | References |
|---|---|---|---|---|---|---|
| Class I MHC | B2MHLA-G | P17693P61769 | 2:2 | KEGG-MEDICUSSIGNORPDB | SIGNOR:SIGNOR-C425PDB:3kynPDB:3kyo | |
| Class I MHC:Antigen | B2MCHEBI:166824HLA-G | CHEBI:166824P17693P61769 | 0:0:0 | SIGNOR | SIGNOR:SIGNOR-C426 | |
| Mitochondrial transcription initiation complex | POLRMTTFAMTFB2M | O00411Q00059Q9H5Q4 | 2:2:2 | ComplexPortalPDB | PDB:6ERPPDB:9mn5PDB:9mn4PDB:6erqPDB:6erpPDB:6ERQintact:EBI-27123857 | 1475529229149603 |
| A0A140T913B2MKRAS | A0A140T913P01116P61769 | 1:1:1 | PDB | PDB:6o4zPDB:6o51PDB:6o53PDB:6o4y | ||
| A0A140T913AFPB2M | A0A140T913P02771P61769 | 2:2:2 | PDB | PDB:7re7PDB:7re8 | ||
| A0A140T913B2MTP53 | A0A140T913P04637P61769 | 2:2:2 | PDB | PDB:6w51PDB:6vrnPDB:6vr5PDB:6vrmPDB:6vr1PDB:6vqo | ||
| A0A140T913B2MF3 | A0A140T913P13726P61769 | 2:2:2 | PDB | PDB:6z9w | ||
| A0A140T913B2MWT1 | A0A140T913P19544P61769 | 1:1:1 | PDB | PDB:7bbg | ||
| A0A140T913B2MPMEL | A0A140T913P40967P61769 | 1:1:1 | PDB | PDB:6vm8PDB:6vmaPDB:6vmcPDB:6vm7PDB:6vm9 | ||
| A0A140T913B2MMAGEA10 | A0A140T913P43363P61769 | 1:1:1 | PDB | PDB:7qpj |
Page 1 of 9Next
Isolation & Detection Technology (1)
1 record.
| EV Isolation Method | Detection Method | Number of References | References |
|---|---|---|---|
| Differential UltracentrifugationSize Exclusion Chromatography | Mass Spectrometry | 1 | 38037300 |
Sequence, Structure & Domains
Sequences
Length
119
Mass
13,715
Sequence
MSRSVALAVLALLSLSGLEAIQRTPKIQVYSRHPAENGKSNFLNCYVSGFHPSDIEVDLLKNGERIEKVEHSDLSFSKDWSFYLLYYTEFTPTEKDEYACRVNHVTLSQPKIVKWDRDM
3D Structural Models
Turn
93..95; 117..119
Helix
35..37
Beta Strand
21..23; 26..33; 41..53; 56..61; 64..66; 67..69; 71..78; 79..82; 83..88; 98..103; 107..109; 111..114
3D Structure
Electron microscopy (29); NMR spectroscopy (6); X-ray crystallography (1222)
Domain & Motif Annotations
Domain (FT)
25..113; Ig-like C1-type
Protein Families
Beta-2-microglobulin family
Sequence Similarities
Belongs to the beta-2-microglobulin family.
Clinical Relevance
Disease Involvement (3)
AmyloidosisCancer-related genesDisease variant
Related Diseases
Drug Targets
Literature-reported target
Interaction Protein (4)
ENSG00000010704ENSG00000104870ENSG00000206503ENSG00000234745
Interaction Count
4
Interaction Dataset (2)
intact_biogridintact_biogrid_bioplex
Supporting Publications1
| PMID | Title | Related sentences |
|---|---|---|
| 37713494 | ATP1A3 as a target for isolating neuron-specific extracellular vesicles from human brain and biofluids. | No related sentences available |