Protein detail
B2MG
Beta-2-microglobulin [Cleaved into: Beta-2-microglobulin form pI 5.3]
Protein symbol B2MG | UniProt ID | EVMP score 0.38 |
Frequency 1 | Transmembrane count | Protein classification Cancer-related genesDisease related genesHuman disease related genesPlasma proteinsPotential drug targetsPredicted secreted proteinsTransporters |
EVMP score: annotation confidence score.
Extremely high >= 0.85High >= 0.70Medium >= 0.55Low >= 0.40
Basic Information
Protein Names
Beta-2-microglobulin [Cleaved into: Beta-2-microglobulin form pI 5.3]
Protein Class
Cancer-related genesDisease related genesHuman disease related genesPlasma proteinsPotential drug targetsPredicted secreted proteinsTransporters
Protein Function
- Cancer-related genes:Mutational cancer driver genes
- Transporters
- Human disease related genes:Cardiovascular diseases:Hematologic diseases
- Human disease related genes:Nervous system diseases:Neurodegenerative diseases
- Cancer-related genes:Mutated cancer genes
- Potential drug targets
- Cancer-related genes:Candidate cancer biomarkers
- Human disease related genes:Cancers:Cancers of haematopoietic and lymphoid tissues
- Predicted secreted proteins
- Disease related genes
Ensembl
Entrez Gene Symbol
Gene Description
Beta-2-microglobulin
Chromosome
15
Position
44711358-44718851
Frequency
1
EVMP Score
0.38
Fluorescence & Localization
Cell SpecificEsophageal apical cellsSingle-Nuclei Brain SpecificoligodendrocyteBlood Cell Specificintermediate monocyte
Function & Pathway
Protein Function
- Cancer-related genes:Mutational cancer driver genes
- Transporters
- Human disease related genes:Cardiovascular diseases:Hematologic diseases
- Human disease related genes:Nervous system diseases:Neurodegenerative diseases
- Cancer-related genes:Mutated cancer genes
- Potential drug targets
- Cancer-related genes:Candidate cancer biomarkers
- Human disease related genes:Cancers:Cancers of haematopoietic and lymphoid tissues
- Predicted secreted proteins
- Disease related genes
Cellular Component
- GO:0000139 Golgi membrane
- GO:0005576 extracellular region
- GO:0005615 extracellular space
- GO:0005765 lysosomal membrane
- GO:0005783 endoplasmic reticulum
- GO:0005788 endoplasmic reticulum lumen
- GO:0005794 Golgi apparatus
- GO:0005829 cytosol
- GO:0005886 plasma membrane
- GO:0005925 focal adhesion
- GO:0009897 external side of plasma membrane
- GO:0012507 ER to Golgi transport vesicle membrane
- GO:0016020 membrane
- GO:0030670 phagocytic vesicle membrane
- GO:0031901 early endosome membrane
- GO:0031902 late endosome membrane
- GO:0031905 early endosome lumen
- GO:0035580 specific granule lumen
- GO:0042612 MHC class I protein complex
- GO:0042613 MHC class II protein complex
- GO:0042824 MHC class I peptide loading complex
- GO:0055038 recycling endosome membrane
- GO:0070062 extracellular exosome
- GO:1904724 tertiary granule lumen
- GO:1990712 HFE-transferrin receptor complex
Molecular Function
Biological Process
KEGG
Reactome
- R-hsa-1280218 adaptive immune system
- R-hsa-977225 amyloid fiber formation
- R-hsa-983170 antigen presentation folding assembly and peptide loading of class i mhc
- R-hsa-1236975 antigen processing cross presentation
- R-hsa-9824439 bacterial infection pathways
- R-hsa-983169 class i mhc mediated antigen processing presentation
- R-hsa-1280215 cytokine signaling in immune system
- R-hsa-2172127 dap12 interactions
- R-hsa-2424491 dap12 signaling
- R-hsa-1236977 endosomal vacuolar pathway
- R-hsa-162906 hiv infection
- R-hsa-162909 host interactions of hiv factors
- R-hsa-198933 immunoregulatory interactions between a lymphoid and a non lymphoid cell
- R-hsa-9635486 infection with mycobacterium tuberculosis
- R-hsa-5663205 infectious disease
- R-hsa-168249 innate immune system
- R-hsa-877300 interferon gamma signaling
- R-hsa-913531 interferon signaling
- R-hsa-9637628 modulation by mtb of host immune system
- R-hsa-164940 nef mediated downregulation of mhc class i complex cell surface expression
- R-hsa-164938 nef mediates down modulation of cell surface receptors by recruiting them to clathrin adapters
- R-hsa-6798695 neutrophil degranulation
- R-hsa-9705671 sars cov 2 activates modulates innate and adaptive immune responses
- R-hsa-9705683 sars cov 2 host interactions
- R-hsa-9694516 sars cov 2 infection
- R-hsa-9679506 sars cov infections
- R-hsa-164952 the role of nef in hiv 1 replication and disease pathogenesis
- R-hsa-9824446 viral infection pathways
Mediation Categories
Adhesion and uptake mediationClinical-translation mediationFusion and delivery mediationImmune mediationMetabolism mediation
Relations & Evidence
Enzyme-Mediated Modification
0 records.
Ligand-Receptor Signaling
17 records.
| Category | Parent | Database | Transmitter | Receiver | Secreted | Plasma Membrane (Transmembrane) | Plasma Membrane (Peripheral) |
|---|---|---|---|---|---|---|---|
| ecm | ecm | GO_Intercell | Yes | No | Yes | No | No |
| ecm | ecm | OmniPath | Yes | No | Yes | No | No |
| extracellular | extracellular | DGIdb | No | No | Yes | No | No |
| extracellular | extracellular | LOCATE | No | No | Yes | No | No |
| extracellular | extracellular | OmniPath | No | No | Yes | No | No |
| intracellular | intracellular | ComPPI | No | No | Yes | No | No |
| intracellular | intracellular | GO_Intercell | No | No | Yes | No | No |
| intracellular | intracellular | OmniPath | No | No | Yes | No | No |
| cell_surface_ligand | cell_surface_ligand | CellPhoneDB | Yes | No | Yes | No | No |
| cell_surface_ligand | cell_surface_ligand | OmniPath | Yes | No | Yes | No | No |
Page 1 of 2Next
Regulatory Interaction Network
0 records.
Protein Complex Composition
90 records.
| Component Name | Component Gene Symbols | Component UniProt ID | Stoichiometry | Database | Database IDs | References |
|---|---|---|---|---|---|---|
| A0A140T913B2M | A0A140T913P61769 | 2:2 | PDB | PDB:6z9vPDB:6z9x | ||
| A0A140T913B2MPGM5 | A0A140T913P61769Q15124 | 2:2:2 | PDB | PDB:7u21 | ||
| A0A140T913B2MMLANA | A0A140T913P61769Q16655 | 4:2:2 | PDB | PDB:7q9b | ||
| A0A140T913B2MIGFBPL1 | A0A140T913P61769Q8WX77 | 1:1:1 | PDB | PDB:7mj6PDB:7mj9PDB:7mj8PDB:7mj7 | ||
| A0A140T913B2MSNX24 | A0A140T913P61769Q9Y343 | 2:2:2 | PDB | PDB:8u9gPDB:8tbw | ||
| A0A140T913B2MIGF2BP2 | A0A140T913P61769Q9Y6M1 | 5:5:5 | PDB | PDB:7q99PDB:7q98 | ||
| A0A140T9X5B2M | A0A140T9X5P61769 | 3:3 | PDB | PDB:8eb2 | ||
| A0A140T9X5B2MMLANA | A0A140T9X5P61769Q16655 | 1:1:1 | PDB | PDB:7tr4 | ||
| A0A2R7Z5J3B2M | A0A2R7Z5J3P61769 | 1:1 | PDB | PDB:6y27PDB:6y2bPDB:6y29 | ||
| A0A2R8Y7R8A3F718B2M | A0A2R8Y7R8A3F718P61769 | 1:1:1 | PDB | PDB:7n2p |
Isolation & Detection Technology
1 record.
| EV Isolation Method | Detection Method | Number of References | References |
|---|---|---|---|
| Differential UltracentrifugationSize Exclusion Chromatography | Mass Spectrometry | 1 | 38037300 |
Sequence, Structure & Domains
Sequences
Length
119
Mass
13,715
Sequence
MSRSVALAVLALLSLSGLEAIQRTPKIQVYSRHPAENGKSNFLNCYVSGFHPSDIEVDLLKNGERIEKVEHSDLSFSKDWSFYLLYYTEFTPTEKDEYACRVNHVTLSQPKIVKWDRDM
3D Structural Models
Turn
93..95; 117..119
Helix
35..37
Beta Strand
21..23; 26..33; 41..53; 56..61; 64..66; 67..69; 71..78; 79..82; 83..88; 98..103; 107..109; 111..114
3D Structure
Electron microscopy (29); NMR spectroscopy (6); X-ray crystallography (1222)
Domain & Motif Annotations
Domain (FT)
25..113; Ig-like C1-type
Protein Families
Beta-2-microglobulin family
Sequence Similarities
Belongs to the beta-2-microglobulin family.
Clinical Relevance
Disease Involvement
AmyloidosisCancer-related genesDisease variant
Drug Targets
Literature-reported target
Interaction Protein
ENSG00000010704ENSG00000104870ENSG00000206503ENSG00000234745
Interaction Count
4
Interaction Dataset
intact_biogridintact_biogrid_bioplex