Protein detail
CANB1
Calcineurin subunit B type 1 (Protein phosphatase 2B regulatory subunit 1) (Protein phosphatase 3 regulatory subunit B alpha isoform 1)
Protein symbol CANB1 | UniProt ID | EVMP score 0.50 |
Frequency 1 | Transmembrane count | Protein classification FDA approved drug targetsPredicted intracellular proteins |
EVMP score: annotation confidence score.
Extremely high >= 0.85High >= 0.70Medium >= 0.55Low >= 0.40
Basic Information
Protein Names
Calcineurin subunit B type 1 (Protein phosphatase 2B regulatory subunit 1) (Protein phosphatase 3 regulatory subunit B alpha isoform 1)
Protein Class
FDA approved drug targetsPredicted intracellular proteins
Protein Function
- FDA approved drug targets:Small molecule drugs
- Predicted intracellular proteins
Ensembl
Entrez Gene Symbol
Gene Synonym
CALNB1CNBCNB1
Gene Description
Protein phosphatase 3 regulatory subunit B, alpha
Chromosome
2
Position
68178857-68256237
Frequency
1
EVMP Score
0.50
Fluorescence & Localization
Cell SpecificB-cellsSingle-Nuclei Brain Specificleukocyte
Function & Pathway
Protein Function
- FDA approved drug targets:Small molecule drugs
- Predicted intracellular proteins
Cellular Component
- GO:0005654 nucleoplasm
- GO:0005829 cytosol
- GO:0005955 calcineurin complex
- GO:0008287 protein serine/threonine phosphatase complex
- GO:0042383 sarcolemma
- GO:0098685 Schaffer collateral - CA1 synapse
- GO:0098686 hippocampal mossy fiber to CA3 synapse
- GO:0098688 parallel fiber to Purkinje cell synapse
- GO:0098794 postsynapse
- GO:0098978 glutamatergic synapse
Molecular Function
- GO:0004723 calcium-dependent protein serine/threonine phosphatase activity
- GO:0005509 calcium ion binding
- GO:0005515 protein binding
- GO:0005516 calmodulin binding
- GO:0008597 calcium-dependent protein serine/threonine phosphatase regulator activity
- GO:0019902 phosphatase binding
- GO:0019904 protein domain specific binding
KEGG
- hsa04010 MAPK signaling pathway
- KEGG:hsa04020 Calcium signaling pathway
- KEGG:hsa04022 cGMP-PKG signaling pathway
- KEGG:hsa04114 Oocyte meiosis
- KEGG:hsa04218 Cellular senescence
- KEGG:hsa04310 Wnt signaling pathway
- KEGG:hsa04360 Axon guidance
- KEGG:hsa04370 VEGF signaling pathway
- KEGG:hsa04380 Osteoclast differentiation
- KEGG:hsa04625 C-type lectin receptor signaling pathway
- KEGG:hsa04650 Natural killer cell mediated cytotoxicity
- KEGG:hsa04658 Th1 and Th2 cell differentiation
- KEGG:hsa04659 Th17 cell differentiation
- KEGG:hsa04660 T cell receptor signaling pathway
- KEGG:hsa04662 B cell receptor signaling pathway
- KEGG:hsa04720 Long-term potentiation
- KEGG:hsa04724 Glutamatergic synapse
- KEGG:hsa04921 Oxytocin signaling pathway
- KEGG:hsa04922 Glucagon signaling pathway
- KEGG:hsa04924 Renin secretion
- KEGG:hsa05010 Alzheimer disease
- KEGG:hsa05014 Amyotrophic lateral sclerosis
- KEGG:hsa05020 Prion disease
- KEGG:hsa05022 Pathways of neurodegeneration - multiple diseases
- KEGG:hsa05031 Amphetamine addiction
- KEGG:hsa05152 Tuberculosis
- KEGG:hsa05163 Human cytomegalovirus infection
- KEGG:hsa05166 Human T-cell leukemia virus 1 infection
- KEGG:hsa05167 Kaposi sarcoma-associated herpesvirus infection
- KEGG:hsa05170 Human immunodeficiency virus 1 infection
- KEGG:hsa05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
- KEGG:hsa05417 Lipid and atherosclerosis
Reactome
- R-hsa-111447 activation of bad and translocation to mitochondria
- R-hsa-114452 activation of bh3 only proteins
- R-hsa-1280218 adaptive immune system
- R-hsa-109581 apoptosis
- R-hsa-3858494 beta catenin independent wnt signaling
- R-hsa-4086398 ca2 pathway
- R-hsa-2025928 calcineurin activates nfat
- R-hsa-5607763 clec7a dectin 1 induces nfat activation
- R-hsa-5607764 clec7a dectin 1 signaling
- R-hsa-5621481 c type lectin receptors clrs
- R-hsa-180024 darpp 32 events
- R-hsa-1168372 downstream signaling events of b cell receptor bcr
- R-hsa-2871809 fceri mediated ca 2 mobilization
- R-hsa-2454202 fc epsilon receptor fceri signaling
- R-hsa-418594 g alpha i signalling events
- R-hsa-168249 innate immune system
- R-hsa-109606 intrinsic pathway for apoptosis
- R-hsa-111885 opioid signalling
- R-hsa-5357801 programmed cell death
- R-hsa-372790 signaling by gpcr
- R-hsa-983705 signaling by the b cell receptor bcr
- R-hsa-195721 signaling by wnt
Mediation Categories
Adhesion and uptake mediationClinical-translation mediationFusion and delivery mediationImmune mediationReceptor-signaling mediation
Relations & Evidence
Enzyme-Mediated Modification
0 records.
Ligand-Receptor Signaling
6 records.
| Category | Parent | Database | Transmitter | Receiver | Secreted | Plasma Membrane (Transmembrane) | Plasma Membrane (Peripheral) |
|---|---|---|---|---|---|---|---|
| intracellular | intracellular | ComPPI | No | No | No | No | No |
| intracellular | intracellular | GO_Intercell | No | No | No | No | No |
| intracellular | intracellular | UniProt_location | No | No | No | No | No |
| intracellular | intracellular | OmniPath | No | No | No | No | No |
| plasma_membrane | plasma_membrane | UniProt_location | No | No | No | No | No |
| plasma_membrane | plasma_membrane | OmniPath | No | No | No | No | No |
Regulatory Interaction Network
0 records.
Protein Complex Composition
24 records.
Isolation & Detection Technology
1 record.
| EV Isolation Method | Detection Method | Number of References | References |
|---|---|---|---|
| PRotein Organic Solvent Precipitation；Differential Ultracentrifugation | Mass spectrometry | 1 | 32384937 |
Sequence, Structure & Domains
Sequences
Length
170
Mass
19,300
Sequence
MGNEASYPLEMCSHFDADEIKRLGKRFKKLDLDNSGSLSVEEFMSLPELQQNPLVQRVIDIFDTDGNGEVDFKEFIEGVSQFSVKGDKEQKLRFAFRIYDMDKDGYISNGELFQVLKMMVGNNLKDTQLQQIVDKTIINADKDGDGRISFEEFCAVVGGLDIHKKMVVDV
3D Structural Models
Helix
9..11; 17..30; 40..44; 47..49; 55..62; 72..80; 88..99; 109..120; 121..123; 126..140; 150..157; 158..160; 162..165
Beta Strand
12..14; 35..38; 67..71; 81..85; 104..107; 144..149
3D Structure
Electron microscopy (4); X-ray crystallography (14)
Domain & Motif Annotations
Domain (FT)
18..46; EF-hand 1; 50..85; EF-hand 2; 87..122; EF-hand 3; 128..163; EF-hand 4
Region
131..136; Calcineurin A binding
Protein Families
Calcineurin regulatory subunit family
Sequence Similarities
Belongs to the calcineurin regulatory subunit family.
Clinical Relevance
Disease Involvement
FDA approved drug targets
Drug Targets
FDA approved drug targets
Drugs
Interaction Protein
ENSG00000120910ENSG00000138814ENSG00000159200
Interaction Count
3
Interaction Dataset
intact_biogrid