Protein detail
CANB1
Calcineurin subunit B type 1 (Protein phosphatase 2B regulatory subunit 1) (Protein phosphatase 3 regulatory subunit B alpha isoform 1)
Entry name CANB1 | UniProt ID | EVMP confidence score 0.40 |
Supporting publications (n) 1 | Transmembrane count | Protein classification FDA approved drug targetsPredicted intracellular proteins |
Annotation confidence score; open for threshold definitions.
Extremely high >= 0.70High >= 0.60Medium >= 0.40Low >= 0.30Basic Information
Protein Names
Calcineurin subunit B type 1 (Protein phosphatase 2B regulatory subunit 1) (Protein phosphatase 3 regulatory subunit B alpha isoform 1)
Protein Class (2)
FDA approved drug targetsPredicted intracellular proteins
Protein Function (2)
- FDA approved drug targets:Small molecule drugs
- Predicted intracellular proteins
Ensembl
Entrez Gene Symbol
Gene Synonym (3)
CALNB1CNBCNB1
Gene Description
Protein phosphatase 3 regulatory subunit B, alpha
Chromosome
2
Position
68178857-68256237
Supporting publications (n)
1
EVMP confidence score
0.40
Fluorescence & Localization
Cell SpecificB-cellsSingle-Nuclei Brain Specificleukocyte
Function & Pathway
Protein Function (2)
- FDA approved drug targets:Small molecule drugs
- Predicted intracellular proteins
Cellular Component (10)
- GO:0005654 nucleoplasm
- GO:0005829 cytosol
- GO:0005955 calcineurin complex
- GO:0008287 protein serine/threonine phosphatase complex
- GO:0042383 sarcolemma
- GO:0098685 Schaffer collateral - CA1 synapse
- GO:0098686 hippocampal mossy fiber to CA3 synapse
- GO:0098688 parallel fiber to Purkinje cell synapse
- GO:0098794 postsynapse
- GO:0098978 glutamatergic synapse
Molecular Function (7)
- GO:0004723 calcium-dependent protein serine/threonine phosphatase activity
- GO:0005509 calcium ion binding
- GO:0005515 protein binding
- GO:0005516 calmodulin binding
- GO:0008597 calcium-dependent protein serine/threonine phosphatase regulator activity
- GO:0019902 phosphatase binding
- GO:0019904 protein domain specific binding
KEGG (32)
- hsa04010 MAPK signaling pathway
- KEGG:hsa04020 Calcium signaling pathway
- KEGG:hsa04022 cGMP-PKG signaling pathway
- KEGG:hsa04114 Oocyte meiosis
- KEGG:hsa04218 Cellular senescence
- KEGG:hsa04310 Wnt signaling pathway
- KEGG:hsa04360 Axon guidance
- KEGG:hsa04370 VEGF signaling pathway
- KEGG:hsa04380 Osteoclast differentiation
- KEGG:hsa04625 C-type lectin receptor signaling pathway
Page 1 of 4
Reactome (22)
- R-hsa-111447 activation of bad and translocation to mitochondria
- R-hsa-114452 activation of bh3 only proteins
- R-hsa-1280218 adaptive immune system
- R-hsa-109581 apoptosis
- R-hsa-3858494 beta catenin independent wnt signaling
- R-hsa-4086398 ca2 pathway
- R-hsa-2025928 calcineurin activates nfat
- R-hsa-5607763 clec7a dectin 1 induces nfat activation
- R-hsa-5607764 clec7a dectin 1 signaling
- R-hsa-5621481 c type lectin receptors clrs
Page 1 of 3
Mediation Categories (5)
Adhesion and uptake mediationClinical-translation mediationFusion and delivery mediationImmune mediationReceptor-signaling mediation
Relations & Evidence31
Ligand-Receptor Signaling (6)
6 records.
| Category | Parent | Database | Transmitter | Receiver | Secreted | Plasma Membrane (Transmembrane) | Plasma Membrane (Peripheral) |
|---|---|---|---|---|---|---|---|
| intracellular | intracellular | ComPPI | |||||
| intracellular | intracellular | GO_Intercell | |||||
| intracellular | intracellular | UniProt_location | |||||
| intracellular | intracellular | OmniPath | |||||
| plasma_membrane | plasma_membrane | UniProt_location | |||||
| plasma_membrane | plasma_membrane | OmniPath |
Protein Complex Composition (24)
24 records.
| Component Name | Component Gene Symbols | Component UniProt ID | Stoichiometry | Database | Database IDs | References |
|---|---|---|---|---|---|---|
| CABP1CABP2CABP5NMT1PPP3R1 | P30419P63098Q9NP86Q9NPB3Q9NZU7 | 1:1:1:1:1 | NetworkBlastCompleat | Compleat:HC6082 | ||
| PPP3CCPPP3R1 | P48454P63098 | 0:0 | KEGG-MEDICUS | |||
| PPIAPPP3CAPPP3R1 | P62937P63098Q08209 | 2:2:2 | PDB | PDB:1mf8PDB:1m63 | ||
| FKBP1APPP3R1 | P62942P63098 | 1:1 | PDB | PDB:7u0t |
Page 3 of 3Previous
Isolation & Detection Technology (1)
1 record.
| EV Isolation Method | Detection Method | Number of References | References |
|---|---|---|---|
| PRotein Organic Solvent Precipitation;Differential Ultracentrifugation | Mass spectrometry | 1 | 32384937 |
Sequence, Structure & Domains
Sequences
Length
170
Mass
19,300
Sequence
MGNEASYPLEMCSHFDADEIKRLGKRFKKLDLDNSGSLSVEEFMSLPELQQNPLVQRVIDIFDTDGNGEVDFKEFIEGVSQFSVKGDKEQKLRFAFRIYDMDKDGYISNGELFQVLKMMVGNNLKDTQLQQIVDKTIINADKDGDGRISFEEFCAVVGGLDIHKKMVVDV
3D Structural Models
Helix
9..11; 17..30; 40..44; 47..49; 55..62; 72..80; 88..99; 109..120; 121..123; 126..140; 150..157; 158..160; 162..165
Beta Strand
12..14; 35..38; 67..71; 81..85; 104..107; 144..149
3D Structure
Electron microscopy (4); X-ray crystallography (14)
Domain & Motif Annotations
Domain (FT)
18..46; EF-hand 1; 50..85; EF-hand 2; 87..122; EF-hand 3; 128..163; EF-hand 4
Region
131..136; Calcineurin A binding
Protein Families
Calcineurin regulatory subunit family
Sequence Similarities
Belongs to the calcineurin regulatory subunit family.
Clinical Relevance
Disease Involvement
FDA approved drug targets
Drug Targets
FDA approved drug targets
Drugs
Interaction Protein (3)
ENSG00000120910ENSG00000138814ENSG00000159200
Interaction Count
3
Interaction Dataset
intact_biogrid
Supporting Publications1
| PMID | Title | Related sentences |
|---|---|---|
| 36114323 | Blood plasma derived extracellular vesicles (BEVs): particle purification liquid chromatography (PPLC) and proteomic analysis reveals BEVs as a potential minimally invasive tool for predicting response to breast cancer treatment. | No related sentences available |