Protein detail
EM55
55 kDa erythrocyte membrane protein (p55) (Membrane protein, palmitoylated 1)
Entry name EM55 | UniProt ID | EVMP confidence score 0.72 |
Supporting publications (n) 17 | Transmembrane count | Protein classification Predicted intracellular proteins |
EVMP confidence score
Annotation confidence score; open for threshold definitions.
Extremely high >= 0.85High >= 0.70Medium >= 0.55Low >= 0.40Basic Information11
Protein Names
55 kDa erythrocyte membrane protein (p55) (Membrane protein, palmitoylated 1)
Protein Class
Predicted intracellular proteins
Protein Function
Predicted intracellular proteins
Ensembl
Entrez Gene Symbol
Gene Synonym (2)
DXS552EPEMP
Gene Description
MAGUK p55 scaffold protein 1
Chromosome
X
Position
154778684-154821007
Supporting publications (n)
17
EVMP confidence score
0.72
Fluorescence & Localization5
Tissue Specificbone marrowCell SpecificNeutrophil progenitorsSingle-Nuclei Brain Specificcentral nervous system macrophageBlood Cell SpecificneutrophilBlood Lineage SpecificB-cells
Function & Pathway7
Protein Function
Predicted intracellular proteins
Cellular Component (6)
Molecular Function (3)
Biological Process (3)
Reactome (3)
Canonical Pathways (3)
- M267 Pid anthrax pathway
- M69 Pid reelin pathway
- M12705 Sig cd40pathwaymap
Mediation Categories (2)
Fusion and delivery mediationImmune mediation
Relations & Evidence9
Ligand-Receptor Signaling (6)
6 records.
| Category | Parent | Database | Transmitter | Receiver | Secreted | Plasma Membrane (Transmembrane) | Plasma Membrane (Peripheral) |
|---|---|---|---|---|---|---|---|
| intracellular | intracellular | LOCATE | No | No | No | No | No |
| intracellular | intracellular | ComPPI | No | No | No | No | No |
| intracellular | intracellular | GO_Intercell | No | No | No | No | No |
| intracellular | intracellular | OmniPath | No | No | No | No | No |
| plasma_membrane | plasma_membrane | UniProt_location | No | No | No | No | No |
| plasma_membrane | plasma_membrane | OmniPath | No | No | No | No | No |
Protein Complex Composition (2)
Isolation & Detection Technology (1)
1 record.
| EV Isolation Method | Detection Method | Number of References | References |
|---|---|---|---|
| PRotein Organic Solvent Precipitation；Differential Ultracentrifugation | Mass spectrometry | 1 | 32384937 |
Sequence, Structure & Domains13
Sequences
Length
466
Mass
52,296
Sequence
MTLKASEGESGGSMHTALSDLYLEHLLQKRSRPEAVSHPLNTVTEDMYTNGSPAPGSPAQVKGQEVRKVRLIQFEKVTEEPMGITLKLNEKQSCTVARILHGGMIHRQGSLHVGDEILEINGTNVTNHSVDQLQKAMKETKGMISLKVIPNQQSRLPALQMFMRAQFDYDPKKDNLIPCKEAGLKFATGDIIQIINKDDSNWWQGRVEGSSKESAGLIPSPELQEWRVASMAQSAPSEAPSCSPFGKKKKYKDKYLAKHSSIFDQLDVVSYEEVVRLPAFKRKTLVLIGASGVGRSHIKNALLSQNPEKFVYPVPYTTRPPRKSEEDGKEYHFISTEEMTRNISANEFLEFGSYQGNMFGTKFETVHQIHKQNKIAILDIEPQTLKIVRTAELSPFIVFIAPTDQGTQTEALQQLQKDSEAIRSQYAHYFDLSLVNNGVDETLKKLQEAFDQACSSPQWVPVSWVY
Alternative Products
Event=Alternative splicing; Named isoforms=3; Name=1; IsoId=Q00013-1; Sequence=Displayed; Name=2; IsoId=Q00013-2; Sequence=VSP_042675; Name=3; IsoId=Q00013-3; Sequence=VSP_044634
Alternative Sequence
1..34; MTLKASEGESGGSMHTALSDLYLEHLLQKRSRPE -> MESW (in isoform 2); 161..180; Missing (in isoform 3)
3D Structural Models
Turn
125..127; 307..309; 391..393
Helix
104..108; 131..139; 295..305; 336..344; 363..371; 382..384; 385..388; 410..426; 427..429; 439..452
Beta Strand
70..76; 78..80; 83..88; 94..99; 101..103; 116..120; 142..149; 284..288; 348..354; 357..362; 375..379; 395..402; 405..407; 431..437
3D Structure
NMR spectroscopy (2); X-ray crystallography (1)
Domain & Motif Annotations
Domain (FT)
71..152; PDZ; 158..228; SH3; 282..451; Guanylate kinase-like
Region
268..466; Interaction with PALS1
Protein Families
MAGUK family
Sequence Similarities
Belongs to the MAGUK family.
Clinical Relevance4
Antibody
Interaction Protein (2)
ENSG00000123240ENSG00000125257
Interaction Count
2
Interaction Dataset
intact_biogrid
Supporting Publications17
| PMID | Title | Abstract |
|---|---|---|
| 27086912 | Comparative proteomics of exosomes secreted by tumoral Jurkat T cells and normal human T cell blasts unravels a potential tumorigenic role for valosin-containing protein. | No abstract available |
| 27821849 | Detailed Analysis of Protein Topology of Extracellular Vesicles-Evidence of Unconventional Membrane Protein Orientation. | No abstract available |
| 31617158 | Proteomic profiling of peritoneal dialysis effluent-derived extracellular vesicles: a longitudinal study. | No abstract available |
| 32230970 | Radiation Exposure of Peripheral Mononuclear Blood Cells Alters the Composition and Function of Secreted Extracellular Vesicles. | No abstract available |
| 33592500 | A Proteomic Approach to Understand the Clinical Significance of Acute Myeloid Leukemia-Derived Extracellular Vesicles Reflecting Essential Characteristics of Leukemia. | No abstract available |
| 34576246 | Burn Injury Induces Proinflammatory Plasma Extracellular Vesicles That Associate with Length of Hospital Stay in Women: CRP and SAA1 as Potential Prognostic Indicators. | No abstract available |
| 36982312 | Saliva and Saliva Extracellular Vesicles for Biomarker Candidate Identification-Assay Development and Pilot Study in Amyotrophic Lateral Sclerosis. | No abstract available |
| 37211381 | Plasma exosome proteomics reveals the pathogenesis mechanism of post-stroke cognitive impairment. | No abstract available |
| 37322475 | Comprehensive profiling of extracellular vesicles in uveitis and scleritis enables biomarker discovery and mechanism exploration. | No abstract available |
| 37438638 | Extracellular Vesicles Play a Central Role in Cerebral Venous Disease-Associated Brain Atrophy. | No abstract available |
Page 1 of 2Next