Protein detail

EM55

55 kDa erythrocyte membrane protein (p55) (Membrane protein, palmitoylated 1)

Entry name EM55	UniProt ID Q00013	EVMP confidence score 0.72
Supporting publications (n) 17	Transmembrane count	Protein classification Predicted intracellular proteins

EVMP confidence score

Annotation confidence score; open for threshold definitions.

Extremely high >= 0.85High >= 0.70Medium >= 0.55Low >= 0.40

Basic Information11

Protein Names

55 kDa erythrocyte membrane protein (p55) (Membrane protein, palmitoylated 1)

Protein Class

Predicted intracellular proteins

Protein Function

Predicted intracellular proteins

Ensembl

ENSG00000130830

Entrez Gene Symbol

MPP1

Gene Synonym (2)

DXS552EPEMP

Gene Description

MAGUK p55 scaffold protein 1

Chromosome

Position

154778684-154821007

Supporting publications (n)

EVMP confidence score

0.72

Fluorescence & Localization5

Tissue Specificbone marrowCell SpecificNeutrophil progenitorsSingle-Nuclei Brain Specificcentral nervous system macrophageBlood Cell SpecificneutrophilBlood Lineage SpecificB-cells

Function & Pathway7

Protein Function

Predicted intracellular proteins

Cellular Component (6)

Molecular Function (3)

Biological Process (3)

Reactome (3)

Canonical Pathways (3)

M267 Pid anthrax pathway
M69 Pid reelin pathway
M12705 Sig cd40pathwaymap

Mediation Categories (2)

Fusion and delivery mediationImmune mediation

Relations & Evidence9

Ligand-Receptor Signaling (6)

6 records.

Category	Parent	Database	Transmitter	Receiver	Secreted	Plasma Membrane (Transmembrane)	Plasma Membrane (Peripheral)
intracellular	intracellular	LOCATE	No	No	No	No	No
intracellular	intracellular	ComPPI	No	No	No	No	No
intracellular	intracellular	GO_Intercell	No	No	No	No	No
intracellular	intracellular	OmniPath	No	No	No	No	No
plasma_membrane	plasma_membrane	UniProt_location	No	No	No	No	No
plasma_membrane	plasma_membrane	OmniPath	No	No	No	No	No

Protein Complex Composition (2)

2 records.

Component Name	Component Gene Symbols	Component UniProt ID	Stoichiometry	Database	Database IDs	References
	AGFG1 BLVRB BROX MPP1	P30043 P52594 Q00013 Q5VW32	0:0:0:0	hu.MAP
	MPP1	Q00013	6	PDB	PDB:3ney

Isolation & Detection Technology (1)

1 record.

EV Isolation Method	Detection Method	Number of References	References
PRotein Organic Solvent Precipitation；Differential Ultracentrifugation	Mass spectrometry	1	32384937

Sequence, Structure & Domains13

Sequences

Length

466

Mass

52,296

Sequence

MTLKASEGESGGSMHTALSDLYLEHLLQKRSRPEAVSHPLNTVTEDMYTNGSPAPGSPAQVKGQEVRKVRLIQFEKVTEEPMGITLKLNEKQSCTVARILHGGMIHRQGSLHVGDEILEINGTNVTNHSVDQLQKAMKETKGMISLKVIPNQQSRLPALQMFMRAQFDYDPKKDNLIPCKEAGLKFATGDIIQIINKDDSNWWQGRVEGSSKESAGLIPSPELQEWRVASMAQSAPSEAPSCSPFGKKKKYKDKYLAKHSSIFDQLDVVSYEEVVRLPAFKRKTLVLIGASGVGRSHIKNALLSQNPEKFVYPVPYTTRPPRKSEEDGKEYHFISTEEMTRNISANEFLEFGSYQGNMFGTKFETVHQIHKQNKIAILDIEPQTLKIVRTAELSPFIVFIAPTDQGTQTEALQQLQKDSEAIRSQYAHYFDLSLVNNGVDETLKKLQEAFDQACSSPQWVPVSWVY

Alternative Products

Event=Alternative splicing; Named isoforms=3; Name=1; IsoId=Q00013-1; Sequence=Displayed; Name=2; IsoId=Q00013-2; Sequence=VSP_042675; Name=3; IsoId=Q00013-3; Sequence=VSP_044634

Alternative Sequence

1..34; MTLKASEGESGGSMHTALSDLYLEHLLQKRSRPE -> MESW (in isoform 2); 161..180; Missing (in isoform 3)

3D Structural Models

Turn

125..127; 307..309; 391..393

Helix

104..108; 131..139; 295..305; 336..344; 363..371; 382..384; 385..388; 410..426; 427..429; 439..452

Beta Strand

70..76; 78..80; 83..88; 94..99; 101..103; 116..120; 142..149; 284..288; 348..354; 357..362; 375..379; 395..402; 405..407; 431..437

3D Structure

NMR spectroscopy (2); X-ray crystallography (1)

Domain & Motif Annotations

Domain (FT)

71..152; PDZ; 158..228; SH3; 282..451; Guanylate kinase-like

Region

268..466; Interaction with PALS1

Protein Families

MAGUK family

Sequence Similarities

Belongs to the MAGUK family.

Clinical Relevance4

Antibody

HPA076675

Interaction Protein (2)

ENSG00000123240ENSG00000125257

Interaction Count

Interaction Dataset

intact_biogrid

Supporting Publications17

PMID	Title	Abstract
38014595	Proteome and immune responses of extracellular vesicles derived from macrophages infected with the periodontal pathogen Tannerella forsythia.	No abstract available
38113368	In-Depth Proteome Profiling of Small Extracellular Vesicles Isolated from Cancer Cell Lines and Patient Serum.	No abstract available
38716512	Assessment of urine sample collection and processing variables for extracellular vesicle-based proteomics.	No abstract available
40730843	Single urinary extracellular vesicle proteomics identifies complement receptor CD35 as a biomarker for sepsis-associated acute kidney injury.	No abstract available
40840701	Multiomics analysis to evaluate the enrichment of extracellular vesicles from human plasma.	No abstract available
41068253	Identification of plasma extracellular vesicle protein biomarkers in diabetic retinopathy progression.	No abstract available
41307968	Extracellular Vesicles Define Discrete Nano-Based Niches Within the Human Haematopoietic System.	No abstract available

Page 2 of 2Previous