Protein detail

DDR1

Epithelial discoidin domain-containing receptor 1 (Epithelial discoidin domain receptor 1) (EC 2.7.10.1) (CD167 antigen-like family member A) (Cell adhesion kinase) (Discoidin receptor tyrosine kinase) (HGK2) (Mammary carcinoma kinase 10) (MCK-10) (Protein-tyrosine kinase 3A) (Protein-tyrosine kinase RTK-6) (TRK E) (Tyrosine kinase DDR) (Tyrosine-protein kinase CAK) (CD antigen CD167a)

Protein symbol DDR1	UniProt ID Q08345	EVMP score 0.50
Frequency 1	Transmembrane count 1	Protein classification CD markersEnzymesPredicted intracellular proteinsPredicted membrane proteins

EVMP score: annotation confidence score.

Extremely high >= 0.85High >= 0.70Medium >= 0.55Low >= 0.40

Basic Information

Protein Names

Protein Class

CD markersEnzymesPredicted intracellular proteinsPredicted membrane proteins

Protein Function

Predicted intracellular proteins
ENZYME proteins:Transferases
CD markers
Enzymes
Kinases:Tyr protein kinases

Transmembrane

418..438; Helical

Transmembrane Count

Ensembl

ENSG00000204580

Entrez Gene Symbol

DDR1

Gene Synonym

CAKCD167EDDR1NEPNTRK4PTK3ARTK6

Gene Description

Discoidin domain receptor tyrosine kinase 1

Chromosome

Position

30876421-30900156

Frequency

EVMP Score

0.50

Fluorescence & Localization

Function & Pathway

Protein Function

Predicted intracellular proteins
ENZYME proteins:Transferases
CD markers
Enzymes
Kinases:Tyr protein kinases

Cellular Component

Molecular Function

Biological Process

Reactome

Mediation Categories

Adhesion and uptake mediationClinical-translation mediationReceptor-signaling mediation

Relations & Evidence

Enzyme-Mediated Modification

2 records.

Substrate Gene Symbol	Enzyme Gene Symbol	Enzyme UniProt ID	Residue Type	Residue Offset	Modification	Database	References
DDR1	NEK6	Q9HC98	S	788	phosphorylation	PhosphoSitePhosphoSite_ProtMapperProtMapper
DDR1	NEK6	Q9HC98	S	794	phosphorylation	MIMPphosphoELM_MIMPPhosphoSite_MIMP

Ligand-Receptor Signaling

63 records.

Category	Parent	Database	Transmitter	Receiver	Secreted	Plasma Membrane (Transmembrane)	Plasma Membrane (Peripheral)
discoidin_domain_receptor	receptor	HPMR	No	Yes	Yes	Yes	No
kinase	receptor	Surfaceome	No	Yes	Yes	Yes	No
ecm_interaction	receptor	ICELLNET	No	Yes	Yes	Yes	No
ecm_interaction_col	receptor	ICELLNET	No	Yes	Yes	Yes	No
receptor	receptor	OmniPath	No	Yes	Yes	Yes	No
extracellular	extracellular	HPMR	No	No	Yes	Yes	No
extracellular	extracellular	OmniPath	No	No	Yes	Yes	No
intracellular	intracellular	LOCATE	No	No	Yes	Yes	No
intracellular	intracellular	ComPPI	No	No	Yes	Yes	No
intracellular	intracellular	GO_Intercell	No	No	Yes	Yes	No

Page 2 of 7Previous Next

Regulatory Interaction Network

5 records.

Source Protein Symbol	Source UniProt ID	Target Protein Symbol	Target UniProt ID	Is Directed	Is Stimulation	Is Inhibition	Database	References
DDR1	Q08345	SHC1	P29353	Yes	Yes	No	HPRDPhosphoPointSignaLink3	HPRD:10783152 SignaLink3:9659899 SignaLink3:23331499
CO1A1	P02452	DDR1	Q08345	Yes	Yes	No	iTALKICELLNETSIGNORInnateDBHPMR_talklrHPMRtalklrRamilowski2015_Baccin2019WangRamilowski2015HPMR_LRdbBaccin2019CellinkerEMBRACEFantom5_LRdbCellTalkDBHPMR_CellinkerconnectomeDB2020LRdb	ICELLNET:21421911 SIGNOR:17318226 HPMR:9659900 CellTalkDB:9659900 Cellinker:9659900 Baccin2019:9659900 ICELLNET:9659900 InnateDB:21815193 connectomeDB2020:9659900 SIGNOR:9659900 ICELLNET:16626936 LRdb:9659900
DDR1	Q08345	T4S1	P30408	Yes	Yes	No	HPRDSPIKE_LCPhosphoPointSIGNOR	SIGNOR:30187813 HPRD:16169070 SPIKE_LC:16169070
DDR1	Q08345	PTN11	Q06124	Yes	Yes	No	HPRDSPIKE_LCPhosphoPointSIGNOR	SIGNOR:16611743 SPIKE_LC:16337946 HPRD:16337946
COLA1	Q96P44	DDR1	Q08345	Yes	Yes	No	SIGNOR	SIGNOR:17318226

Protein Complex Composition

2 records.

Component Name	Component Gene Symbols	Component UniProt ID	Stoichiometry	Database	Database IDs	References
DDR1-PRKCZ-WWC1 complex	DDR1 PRKCZ WWC1	Q05513 Q08345 Q8IX03	0:0:0	CORUM	CORUM:6294	18190796
	DDR1	Q08345	2	PDB	PDB:5sayPDB:7bcmPDB:5fdxPDB:6gwrPDB:6hp9PDB:3zosPDB:4bkjPDB:6y23

Isolation & Detection Technology

1 record.

EV Isolation Method	Detection Method	Number of References	References
Protein Organic Solvent Precipitation	Mass Spectrometry	1	32384937

Sequence, Structure & Domains

Sequences

Length

913

Mass

101,128

Sequence

MGPEALSSLLLLLLVASGDADMKGHFDPAKCRYALGMQDRTIPDSDISASSSWSDSTAARHSRLESSDGDGAWCPAGSVFPKEEEYLQVDLQRLHLVALVGTQGRHAGGLGKEFSRSYRLRYSRDGRRWMGWKDRWGQEVISGNEDPEGVVLKDLGPPMVARLVRFYPRADRVMSVCLRVELYGCLWRDGLLSYTAPVGQTMYLSEAVYLNDSTYDGHTVGGLQYGGLGQLADGVVGLDDFRKSQELRVWPGYDYVGWSNHSFSSGYVEMEFEFDRLRAFQAMQVHCNNMHTLGARLPGGVECRFRRGPAMAWEGEPMRHNLGGNLGDPRARAVSVPLGGRVARFLQCRFLFAGPWLLFSEISFISDVVNNSSPALGGTFPPAPWWPPGPPPTNFSSLELEPRGQQPVAKAEGSPTAILIGCLVAIILLLLLIIALMLWRLHWRRLLSKAERRVLEEELTVHLSVPGDTILINNRPGPREPPPYQEPRPRGNPPHSAPCVPNGSALLLSNPAYRLLLATYARPPRGPGPPTPAWAKPTNTQAYSGDYMEPEKPGAPLLPPPPQNSVPHYAEADIVTLQGVTGGNTYAVPALPPGAVGDGPPRVDFPRSRLRFKEKLGEGQFGEVHLCEVDSPQDLVSLDFPLNVRKGHPLLVAVKILRPDATKNARNDFLKEVKIMSRLKDPNIIRLLGVCVQDDPLCMITDYMENGDLNQFLSAHQLEDKAAEGAPGDGQAAQGPTISYPMLLHVAAQIASGMRYLATLNFVHRDLATRNCLVGENFTIKIADFGMSRNLYAGDYYRVQGRAVLPIRWMAWECILMGKFTTASDVWAFGVTLWEVLMLCRAQPFGQLTDEQVIENAGEFFRDQGRQVYLSRPPACPQGLYELMLRCWSRESEQRPPFSQLHRFLAEDALNTV

Alternative Products

Event=Alternative splicing; Named isoforms=5; Name=1; Synonyms=CAK I, DDR1b; IsoId=Q08345-1; Sequence=Displayed; Name=2; Synonyms=CAK II, DDR1a, Short; IsoId=Q08345-2; Sequence=VSP_002953; Name=3; Synonyms=DDR1d; IsoId=Q08345-4; Sequence=VSP_036916, VSP_036917; Name=4; IsoId=Q08345-5; Sequence=VSP_038057; Name=5; IsoId=Q08345-6; Sequence=VSP_043582, VSP_002953

Alternative Sequence

1; M -> MSLPRCCPHPLRPEGSGAM (in isoform 5); 190..243; GLLSYTAPVGQTMYLSEAVYLNDSTYDGHTVGGLQYGGLGQLADGVVGLDDFRK -> CSMGVWASWQMVWWGWMTLGRVRSCGSGQAMTMWDGATTASPVAMWRWSLSLTG (in isoform 3); 244..913; Missing (in isoform 3); 506..542; Missing (in isoform 2 and isoform 5); 665; A -> ASFSLFS (in isoform 4)

3D Structural Models

Turn

37..39; 68..70; 251..254; 838..840; 844..847

Helix

44..46; 55..57; 59..61; 107..109; 230..232; 260..262; 291..293; 607..609; 632..634; 663..676; 709..714; 740..759; 769..771; 776..778; 786..788; 790..795; 807..809; 812..817; 822..837; 850..862; 878..887; 892..894; 898..907; 908..911

Beta Strand

47..50; 71..73; 87..103; 116..127; 129..131; 145..148; 151..169; 171..173; 178..186; 191..197; 204..206; 217..220; 223..226; 239..241; 245..248; 256..259; 266..287; 299..306; 308..312; 314..316; 318..321; 332..351; 353..367; 582..584; 610..618; 620..631; 638..640; 646..648; 651..657; 687..691; 693..696; 698..702; 717..720; 736..738; 772..774; 780..782; 796..799; 802..805

3D Structure

X-ray crystallography (34)

Domain & Motif Annotations

Compositional Bias

479..496; Pro residues

Motif

481..484; PPxY motif

Domain (CC)

The Gly/Pro-rich domains may be required for an unusual geometry of interaction with ligand or substrates.

Domain (FT)

31..185; F5/8 type C; 610..905; Protein kinase

Region

192..367; DS-like domain; 470..499; Disordered

Protein Families

Protein kinase superfamily
Tyr protein kinase family
Insulin receptor subfamily

Sequence Similarities

Belongs to the protein kinase superfamily. Tyr protein kinase family. Insulin receptor subfamily.

Clinical Relevance

Drug Targets

Clinical trial target

Drugs

IMATINIB PAK-104P

Antibody

CAB010162 CAB025656 HPA074209

Interaction Protein

ENSG00000116741ENSG00000162733

Interaction Count

Interaction Dataset

intact_biogrid