Protein detail
DDR1
Epithelial discoidin domain-containing receptor 1 (Epithelial discoidin domain receptor 1) (EC 2.7.10.1) (CD167 antigen-like family member A) (Cell adhesion kinase) (Discoidin receptor tyrosine kinase) (HGK2) (Mammary carcinoma kinase 10) (MCK-10) (Protein-tyrosine kinase 3A) (Protein-tyrosine kinase RTK-6) (TRK E) (Tyrosine kinase DDR) (Tyrosine-protein kinase CAK) (CD antigen CD167a)
Entry name DDR1 | UniProt ID | EVMP confidence score 0.53 |
Supporting publications (n) 1 | Transmembrane count 1 | Protein classification CD markersEnzymesPredicted intracellular proteinsPredicted membrane proteins |
Annotation confidence score; open for threshold definitions.
Extremely high >= 0.70High >= 0.60Medium >= 0.40Low >= 0.30Basic Information
Protein Names
Epithelial discoidin domain-containing receptor 1 (Epithelial discoidin domain receptor 1) (EC 2.7.10.1) (CD167 antigen-like family member A) (Cell adhesion kinase) (Discoidin receptor tyrosine kinase) (HGK2) (Mammary carcinoma kinase 10) (MCK-10) (Protein-tyrosine kinase 3A) (Protein-tyrosine kinase RTK-6) (TRK E) (Tyrosine kinase DDR) (Tyrosine-protein kinase CAK) (CD antigen CD167a)
Protein Class (4)
CD markersEnzymesPredicted intracellular proteinsPredicted membrane proteins
Protein Function (5)
- Predicted intracellular proteins
- ENZYME proteins:Transferases
- CD markers
- Enzymes
- Kinases:Tyr protein kinases
Transmembrane
418..438; Helical
Transmembrane Count
1
Ensembl
Entrez Gene Symbol
Gene Synonym (7)
CAKCD167EDDR1NEPNTRK4PTK3ARTK6
Gene Description
Discoidin domain receptor tyrosine kinase 1
Chromosome
6
Position
30876421-30900156
Supporting publications (n)
1
EVMP confidence score
0.53
Fluorescence & Localization
Function & Pathway
Protein Function (5)
- Predicted intracellular proteins
- ENZYME proteins:Transferases
- CD markers
- Enzymes
- Kinases:Tyr protein kinases
Cellular Component (4)
Molecular Function (6)
Biological Process (3)
Reactome (2)
Mediation Categories (3)
Adhesion and uptake mediationClinical-translation mediationReceptor-signaling mediation
Relations & Evidence73
Enzyme-Mediated Modification (2)
Ligand-Receptor Signaling (63)
63 records.
| Category | Parent | Database | Transmitter | Receiver | Secreted | Plasma Membrane (Transmembrane) | Plasma Membrane (Peripheral) |
|---|---|---|---|---|---|---|---|
| intracellular | intracellular | OmniPath | Yes | Yes | |||
| cell_adhesion | cell_adhesion | Cellinker | Yes | Yes | Yes | Yes | |
| cell_adhesion | cell_adhesion | Zhong2015 | Yes | Yes | Yes | Yes | |
| icam | cell_adhesion | Zhong2015 | Yes | Yes | Yes | Yes | |
| matrix_adhesion | matrix_adhesion | Cellinker | Yes | Yes | Yes | ||
| adhesion | adhesion | OmniPath | Yes | Yes | Yes | Yes | |
| cell_adhesion | cell_adhesion | OmniPath | Yes | Yes | Yes | Yes | |
| matrix_adhesion | matrix_adhesion | OmniPath | Yes | Yes | Yes | ||
| transmembrane | transmembrane | UniProt_location | Yes | Yes | |||
| transmembrane | transmembrane | UniProt_topology | Yes | Yes |
Regulatory Interaction Network (5)
5 records.
| Source Protein Symbol | Source UniProt ID | Target Protein Symbol | Target UniProt ID | Is Directed | Is Stimulation | Is Inhibition | Database | References |
|---|---|---|---|---|---|---|---|---|
| DDR1 | Q08345 | SHC1 | P29353 | Yes | Yes | HPRDPhosphoPointSignaLink3 | HPRD:10783152SignaLink3:9659899SignaLink3:23331499 | |
| CO1A1 | P02452 | DDR1 | Q08345 | Yes | Yes | iTALKICELLNETSIGNORInnateDBHPMR_talklrHPMRtalklrRamilowski2015_Baccin2019WangRamilowski2015HPMR_LRdbBaccin2019CellinkerEMBRACEFantom5_LRdbCellTalkDBHPMR_CellinkerconnectomeDB2020LRdb | ICELLNET:21421911SIGNOR:17318226HPMR:9659900CellTalkDB:9659900Cellinker:9659900Baccin2019:9659900ICELLNET:9659900InnateDB:21815193connectomeDB2020:9659900SIGNOR:9659900ICELLNET:16626936LRdb:9659900 | |
| DDR1 | Q08345 | T4S1 | P30408 | Yes | Yes | HPRDSPIKE_LCPhosphoPointSIGNOR | SIGNOR:30187813HPRD:16169070SPIKE_LC:16169070 | |
| DDR1 | Q08345 | PTN11 | Q06124 | Yes | Yes | HPRDSPIKE_LCPhosphoPointSIGNOR | SIGNOR:16611743SPIKE_LC:16337946HPRD:16337946 | |
| COLA1 | Q96P44 | DDR1 | Q08345 | Yes | Yes | SIGNOR | SIGNOR:17318226 |
Protein Complex Composition (2)
Isolation & Detection Technology (1)
1 record.
| EV Isolation Method | Detection Method | Number of References | References |
|---|---|---|---|
| Protein Organic Solvent Precipitation | Mass Spectrometry | 1 | 32384937 |
Sequence, Structure & Domains
Sequences
Length
913
Mass
101,128
Sequence
MGPEALSSLLLLLLVASGDADMKGHFDPAKCRYALGMQDRTIPDSDISASSSWSDSTAARHSRLESSDGDGAWCPAGSVFPKEEEYLQVDLQRLHLVALVGTQGRHAGGLGKEFSRSYRLRYSRDGRRWMGWKDRWGQEVISGNEDPEGVVLKDLGPPMVARLVRFYPRADRVMSVCLRVELYGCLWRDGLLSYTAPVGQTMYLSEAVYLNDSTYDGHTVGGLQYGGLGQLADGVVGLDDFRKSQELRVWPGYDYVGWSNHSFSSGYVEMEFEFDRLRAFQAMQVHCNNMHTLGARLPGGVECRFRRGPAMAWEGEPMRHNLGGNLGDPRARAVSVPLGGRVARFLQCRFLFAGPWLLFSEISFISDVVNNSSPALGGTFPPAPWWPPGPPPTNFSSLELEPRGQQPVAKAEGSPTAILIGCLVAIILLLLLIIALMLWRLHWRRLLSKAERRVLEEELTVHLSVPGDTILINNRPGPREPPPYQEPRPRGNPPHSAPCVPNGSALLLSNPAYRLLLATYARPPRGPGPPTPAWAKPTNTQAYSGDYMEPEKPGAPLLPPPPQNSVPHYAEADIVTLQGVTGGNTYAVPALPPGAVGDGPPRVDFPRSRLRFKEKLGEGQFGEVHLCEVDSPQDLVSLDFPLNVRKGHPLLVAVKILRPDATKNARNDFLKEVKIMSRLKDPNIIRLLGVCVQDDPLCMITDYMENGDLNQFLSAHQLEDKAAEGAPGDGQAAQGPTISYPMLLHVAAQIASGMRYLATLNFVHRDLATRNCLVGENFTIKIADFGMSRNLYAGDYYRVQGRAVLPIRWMAWECILMGKFTTASDVWAFGVTLWEVLMLCRAQPFGQLTDEQVIENAGEFFRDQGRQVYLSRPPACPQGLYELMLRCWSRESEQRPPFSQLHRFLAEDALNTV
Alternative Products
Event=Alternative splicing; Named isoforms=5; Name=1; Synonyms=CAK I, DDR1b; IsoId=Q08345-1; Sequence=Displayed; Name=2; Synonyms=CAK II, DDR1a, Short; IsoId=Q08345-2; Sequence=VSP_002953; Name=3; Synonyms=DDR1d; IsoId=Q08345-4; Sequence=VSP_036916, VSP_036917; Name=4; IsoId=Q08345-5; Sequence=VSP_038057; Name=5; IsoId=Q08345-6; Sequence=VSP_043582, VSP_002953
Alternative Sequence
1; M -> MSLPRCCPHPLRPEGSGAM (in isoform 5); 190..243; GLLSYTAPVGQTMYLSEAVYLNDSTYDGHTVGGLQYGGLGQLADGVVGLDDFRK -> CSMGVWASWQMVWWGWMTLGRVRSCGSGQAMTMWDGATTASPVAMWRWSLSLTG (in isoform 3); 244..913; Missing (in isoform 3); 506..542; Missing (in isoform 2 and isoform 5); 665; A -> ASFSLFS (in isoform 4)
3D Structural Models
Turn
37..39; 68..70; 251..254; 838..840; 844..847
Helix
44..46; 55..57; 59..61; 107..109; 230..232; 260..262; 291..293; 607..609; 632..634; 663..676; 709..714; 740..759; 769..771; 776..778; 786..788; 790..795; 807..809; 812..817; 822..837; 850..862; 878..887; 892..894; 898..907; 908..911
Beta Strand
47..50; 71..73; 87..103; 116..127; 129..131; 145..148; 151..169; 171..173; 178..186; 191..197; 204..206; 217..220; 223..226; 239..241; 245..248; 256..259; 266..287; 299..306; 308..312; 314..316; 318..321; 332..351; 353..367; 582..584; 610..618; 620..631; 638..640; 646..648; 651..657; 687..691; 693..696; 698..702; 717..720; 736..738; 772..774; 780..782; 796..799; 802..805
3D Structure
X-ray crystallography (34)
Domain & Motif Annotations
Compositional Bias
479..496; Pro residues
Motif
481..484; PPxY motif
Domain (CC)
The Gly/Pro-rich domains may be required for an unusual geometry of interaction with ligand or substrates.
Domain (FT)
31..185; F5/8 type C; 610..905; Protein kinase
Region
192..367; DS-like domain; 470..499; Disordered
Protein Families (3)
- Protein kinase superfamily
- Tyr protein kinase family
- Insulin receptor subfamily
Sequence Similarities
Belongs to the protein kinase superfamily. Tyr protein kinase family. Insulin receptor subfamily.
Clinical Relevance
Supporting Publications1
| PMID | Title | Related sentences |
|---|---|---|
| 33553692 | Ligand-competent fractalkine receptor is expressed on exosomes. | Although we found that all the exosomes tested in our study highly expressed CX3CR1, this chemokine receptor was expressed only inside, but barely on, their source cells. Here, we investigated CX3CR1 expression on exosomes isolated from various cell types. Therefore, our study suggests that CX3CR1 is a novel and ligand-competent exosome receptor. |