Protein detail
I15RA
Interleukin-15 receptor subunit alpha (IL-15 receptor subunit alpha) (IL-15R-alpha) (IL-15RA) (CD antigen CD215) [Cleaved into: Soluble interleukin-15 receptor subunit alpha (sIL-15 receptor subunit alpha) (sIL-15R-alpha) (sIL-15RA)]
Entry name I15RA | UniProt ID | EVMP confidence score 0.50 |
Supporting publications (n) 1 | Transmembrane count 1 | Protein classification CD markersPredicted intracellular proteinsPredicted membrane proteinsPredicted secreted proteins |
EVMP confidence score
Annotation confidence score; open for threshold definitions.
Extremely high >= 0.85High >= 0.70Medium >= 0.55Low >= 0.40Basic Information13
Protein Names
Interleukin-15 receptor subunit alpha (IL-15 receptor subunit alpha) (IL-15R-alpha) (IL-15RA) (CD antigen CD215) [Cleaved into: Soluble interleukin-15 receptor subunit alpha (sIL-15 receptor subunit alpha) (sIL-15R-alpha) (sIL-15RA)]
Protein Class (4)
CD markersPredicted intracellular proteinsPredicted membrane proteinsPredicted secreted proteins
Protein Function (3)
- Predicted secreted proteins
- CD markers
- Predicted intracellular proteins
Transmembrane
206..228; Helical
Transmembrane Count
1
Ensembl
Entrez Gene Symbol
Gene Synonym (2)
CD215IL-15RA
Gene Description
Interleukin 15 receptor subunit alpha
Chromosome
10
Position
5943639-5978187
Supporting publications (n)
1
EVMP confidence score
0.50
Fluorescence & Localization1
Cell SpecificCytotrophoblasts
Function & Pathway7
Protein Function (3)
- Predicted secreted proteins
- CD markers
- Predicted intracellular proteins
Cellular Component (8)
Molecular Function (4)
Biological Process (3)
KEGG (5)
Reactome (4)
Mediation Categories (2)
Clinical-translation mediationImmune mediation
Relations & Evidence78
Enzyme-Mediated Modification (2)
2 records.
| Substrate Gene Symbol | Enzyme Gene Symbol | Enzyme UniProt ID | Residue Type | Residue Offset | Modification | Database | References |
|---|---|---|---|---|---|---|---|
| IL15RA | SYK | P43405 | Y | 227 | phosphorylation | SIGNOR_ProtMapperKEASIGNORProtMapper | SIGNOR:11714793ProtMapper:11714793KEA:11714793 |
| IL15RA | SYK | P43405 | Y | 191 | phosphorylation | KEA | KEA:11714793 |
Ligand-Receptor Signaling (68)
68 records.
| Category | Parent | Database | Transmitter | Receiver | Secreted | Plasma Membrane (Transmembrane) | Plasma Membrane (Peripheral) |
|---|---|---|---|---|---|---|---|
| transmembrane | transmembrane | Ramilowski_location | No | No | Yes | Yes | No |
| transmembrane | transmembrane | OmniPath | No | No | Yes | Yes | No |
| plasma_membrane_transmembrane | plasma_membrane_transmembrane | Membranome | No | No | Yes | Yes | No |
| plasma_membrane_transmembrane | plasma_membrane_transmembrane | HPMR | No | No | Yes | Yes | No |
| plasma_membrane_transmembrane | plasma_membrane_transmembrane | OmniPath | No | No | Yes | Yes | No |
| secreted | secreted | UniProt_keyword | No | No | Yes | Yes | No |
| secreted | secreted | HPA_secretome | No | No | Yes | Yes | No |
| secreted | secreted | OmniPath | No | No | Yes | Yes | No |
| cell_surface | cell_surface | Surfaceome | No | No | Yes | Yes | No |
| cell_surface | cell_surface | connectomeDB2020 | No | No | Yes | Yes | No |
Regulatory Interaction Network (6)
6 records.
| Source Protein Symbol | Source UniProt ID | Target Protein Symbol | Target UniProt ID | Is Directed | Is Stimulation | Is Inhibition | Database | References |
|---|---|---|---|---|---|---|---|---|
| IL15 | P40933 | I15RA | Q13261 | Yes | Yes | No | iTALKKirouac2010SIGNORHINTSignaLink3InnateDBUniProt_LRdbLit-BM-17HPMR_talklrHPMRHPRD_LRdbtalklrscConnectHPRDIntActDLRP_talklrRamilowski2015_Baccin2019WangRamilowski2015HPMR_LRdbHPRD_talklrBaccin2019STRING_talklrEMBRACECellCallGuide2PharmaCellTalkDBFantom5_LRdbconnectomeDB2020SPIKE_LCLRdb | HINT:16284400Guide2Pharma:19710453SPIKE_LC:17145710connectomeDB2020:16284400connectomeDB2020:15265897Baccin2019:15265897Lit-BM-17:10903799HPRD:7641685CellTalkDB:15265897SIGNOR:17709786HPRD:16284400InnateDB:16284400HPMR:15265897Baccin2019:7641685HINT:17643103LRdb:7641685connectomeDB2020:7641685SignaLink3:23331499SignaLink3:8530383Lit-BM-17:16284400Baccin2019:16284400LRdb:16284400IntAct:16284400LRdb:15265897HINT:23104097 |
| I15RA | Q13261 | JAK3 | P52333 | Yes | Yes | No | WangSIGNOR | SIGNOR:30029643 |
| I15RA | Q13261 | IL2RB | P14784 | Yes | Yes | No | HPRDWangSIGNOR | HPRD:7641685SIGNOR:17709786 |
| I15RA | Q13261 | JAK1 | P23458 | Yes | Yes | No | WangSIGNOR | SIGNOR:30029643 |
| KSYK | P43405 | I15RA | Q13261 | Yes | Yes | No | MIMPHPRD_MIMPiPTMnetPhosphoPointSIGNORProtMapperHPRDPhosphoSite_KEAKEAHPRD_KEASIGNOR_ProtMapper | HPRD:11714793SIGNOR:11714793ProtMapper:11714793KEA:11714793 |
| I15RA | Q13261 | TYK2 | P29597 | Yes | Yes | No | WangSIGNOR | SIGNOR:30029643 |
Protein Complex Composition (1)
Isolation & Detection Technology (1)
1 record.
| EV Isolation Method | Detection Method | Number of References | References |
|---|---|---|---|
| Ultrafiltration / Tangential Flow FiltrationSize Exclusion Chromatography | Mass spectrometry [MALDI TOF]|Mass spectrometry [QTOF]Mass spectrometryMass spectrometry [LTQ-FT Ultra] | 1 | 12519789 |
Sequence, Structure & Domains12
Sequences
Length
267
Mass
28,233
Sequence
MAPRRARGCRTLGLPALLLLLLLRPPATRGITCPPPMSVEHADIWVKSYSLYSRERYICNSGFKRKAGTSSLTECVLNKATNVAHWTTPSLKCIRDPALVHQRPAPPSTVTTAGVTPQPESLSPSGKEPAASSPSSNNTAATTAAIVPGSQLMPSKSPSTGTTEISSHESSHGTPSQTTAKNWELTASASHQPPGVYPQGHSDTTVAISTSTVLLCGLSAVSLLACYLKSRQTPPLASVEMEAMEALPVTWGTSSRDEDLENCSHHL
Alternative Products
Event=Alternative splicing; Named isoforms=9; Name=1; IsoId=Q13261-1; Sequence=Displayed; Name=2; Synonyms=delta3E1E7Il-15RA; IsoId=Q13261-3; Sequence=VSP_012625; Name=3; Synonyms=E1E7'Il-15RA; IsoId=Q13261-4; Sequence=VSP_012626; Name=4; Synonyms=delta3E1E7'Il-15RA; IsoId=Q13261-5; Sequence=VSP_012625, VSP_012626; Name=5; Synonyms=delta2E1E7Il-15RA; IsoId=Q13261-6; Sequence=VSP_012624; Name=6; Synonyms=delta2E1E7'Il-15RA; IsoId=Q13261-7; Sequence=VSP_012624, VSP_012626; Name=7; Synonyms=delta2deltaE1E73Il-15RA; IsoId=Q13261-8; Sequence=VSP_012623; Name=8; Synonyms=delta2delta3E1E7'Il-15RA; IsoId=Q13261-9; Sequence=VSP_012623, VSP_012626; Name=9; IsoId=Q13261-10; Sequence=VSP_055406
Alternative Sequence
1..36; Missing (in isoform 9); 30..127; Missing (in isoform 7 and isoform 8); 31..95; Missing (in isoform 5 and isoform 6); 95..128; RDPALVHQRPAPPSTVTTAGVTPQPESLSPSGKE -> K (in isoform 2 and isoform 4); 232..267; QTPPLASVEMEAMEALPVTWGTSSRDEDLENCSHHL -> ASVCSCHPRSAGHTCSVGSVC (in isoform 3, isoform 4, isoform 6 and isoform 8)
3D Structural Models
Turn
79..81
Helix
97..102
Beta Strand
42..44; 54..59; 63..65; 72..77; 84..86; 93..95
3D Structure
NMR spectroscopy (1); X-ray crystallography (3)
Domain & Motif Annotations
Compositional Bias
108..124; Polar residues; 129..145; Low complexity; 152..165; Polar residues
Domain (FT)
31..95; Sushi
Region
102..178; Disordered
Clinical Relevance4
Related Diseases (10)
Biomarker
Phase 2; Phase 1/2; Phase 1
Supporting Publications1
| PMID | Title | Abstract |
|---|---|---|
| 39277144 | The proteomic signature of circulating extracellular vesicles following intracerebral hemorrhage: Novel insights into mechanisms underlying recovery. | No abstract available |