Protein detail

LSAMP

Limbic system-associated membrane protein (LSAMP) (IgLON family member 3)

Entry name
LSAMP
UniProt ID
EVMP confidence score
0.63
Supporting publications (n)
25
Transmembrane count
Protein classification
Basic Information
Protein Names
Limbic system-associated membrane protein (LSAMP) (IgLON family member 3)
Protein Function
Predicted intracellular proteins
Entrez Gene Symbol
Supporting publications (n)
25
EVMP confidence score
0.63
Fluorescence & Localization
LSAMP fluorescence
Tissue SpecificintestineCell SpecificAlveolar cells type 1
Function & Pathway
Protein Function
Predicted intracellular proteins
Molecular Function
Canonical Pathways (3)
  • M5880 Naba ecm affiliated
  • M5885 Naba matrisome associated
  • M5889 Naba matrisome
Mediation Categories
Metabolism mediation
Relations & Evidence34

Ligand-Receptor Signaling (33)

33 records.

CategoryParentDatabaseTransmitterReceiverSecretedPlasma Membrane (Transmembrane)Plasma Membrane (Peripheral)
transmembrane_phobiustransmembrane_predictedAlmen2009YesYes
transmembrane_sosuitransmembrane_predictedAlmen2009YesYes
transmembrane_tmhmmtransmembrane_predictedAlmen2009YesYes
Page 4 of 4Previous

Isolation & Detection Technology (1)

1 record.

EV Isolation MethodDetection MethodNumber of ReferencesReferences
Differential UltracentrifugationSize Exclusion ChromatographyMass spectrometryWestern blotting138716512
Sequence, Structure & Domains

Sequences

Length
338
Mass
37,393
Sequence
MVRRVQPDRKQLPLVLLRLLCLLPTGLPVRSVDFNRGTDNITVRQGDTAILRCVVEDKNSKVAWLNRSGIIFAGHDKWSLDPRVELEKRHSLEYSLRIQKVDVYDEGSYTCSVQTQHEPKTSQVYLIVQVPPKISNISSDVTVNEGSNVTLVCMANGRPEPVITWRHLTPTGREFEGEEEYLEILGITREQSGKYECKAANEVSSADVKQVKVTVNYPPTITESKSNEATTGRQASLKCEASAVPAPDFEWYRDDTRINSANGLEIKSTEGQSSLTVTNVTEEHYGNYTCVAANKLGVTNASLVLFRPGSVRGINGSISLAVPLWLLAASLLCLLSKC

Domain & Motif Annotations

Domain (FT)
29..122; Ig-like C2-type 1; 132..214; Ig-like C2-type 2; 219..304; Ig-like C2-type 3
Protein Families (2)
  • Immunoglobulin superfamily
  • IgLON family
Sequence Similarities
Belongs to the immunoglobulin superfamily. IgLON family.
Supporting Publications25
PMIDTitleRelated sentences
36146834Human Cytomegalovirus Modifies Placental Small Extracellular Vesicle Composition to Enhance Infection of Fetal Neural Cells In Vitro.No related sentences available
37204515Proteomic profiling and functional characterization of serum-derived extracellular vesicles in the mucinous and non-mucinous colon adenocarcinoma.No related sentences available
37322475Comprehensive profiling of extracellular vesicles in uveitis and scleritis enables biomarker discovery and mechanism exploration.No related sentences available
37926756Extracellular vesicles from non-neuroendocrine SCLC cells promote adhesion and survival of neuroendocrine SCLC cells.No related sentences available
38113368In-Depth Proteome Profiling of Small Extracellular Vesicles Isolated from Cancer Cell Lines and Patient Serum.No related sentences available
38207106Proteomic, Metabolomic, and Fatty Acid Profiling of Small Extracellular Vesicles from Glioblastoma Stem-Like Cells and Their Role in Tumor Heterogeneity.No related sentences available
38590132Proteomic Identification of Small Extracellular Vesicle Proteins LAMB1 and Histone H4 for Prostate Cancer Diagnosis and Risk Stratification.Proteomic Identification of Small Extracellular Vesicle Proteins LAMB1 and Histone H4 for Prostate Cancer Diagnosis and Risk Stratification.
38607062Enrichment, Characterization, and Proteomic Profiling of Small Extracellular Vesicles Derived from Human Limbal Mesenchymal Stromal Cells and Melanocytes.No related sentences available
39001700Optimized AF4 combined with density cushion ultracentrifugation enables profiling of high-purity human blood extracellular vesicles.No related sentences available
39207047The trajectory of vesicular proteomic signatures from HBV-HCC by chitosan-magnetic bead-based separation and DIA-proteomic analysis.No related sentences available
Page 2 of 3PreviousNext